SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 205918.Psyr_3819 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  205918.Psyr_3819
Domain Number 1 Region: 6-180
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-34
Family Beta-D-xylosidase C-terminal domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 205918.Psyr_3819
Sequence length 191
Comment (Pseudomonas syringae pv B728a)
Sequence
MFDKGIWLNQPRHCSVTDERLTVTTDPQTDFWQQTHYGFCRDTGHFLGVSVTGDFTAQVH
VQGDFKTLYDQAGLMVRIDERNWVKTGVEVSDGALMLGSVLTCGQSDWATGVFDESSSGL
WLRVTVAKGVLRIQHSSDGLRWPLLRLAPFPVSDVYKVGPMCCSPERGGLEVVFSHFEVM
PALGKDLHDLT
Download sequence
Identical sequences A0A0Q0A7C7 Q4ZPS3
205918.Psyr_3819 WP_011268672.1.19481 YP_236887.1.68675 gi|66047046|ref|YP_236887.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]