SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 205918.Psyr_4176 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  205918.Psyr_4176
Domain Number 1 Region: 294-489
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.99e-50
Family Ribonuclease PH domain 1-like 0.0000183
Further Details:      
 
Domain Number 2 Region: 3-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.62e-47
Family Ribonuclease PH domain 1-like 0.0000195
Further Details:      
 
Domain Number 3 Region: 451-549
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.23e-28
Family Ribonuclease PH domain 2-like 0.00014
Further Details:      
 
Domain Number 4 Region: 145-237
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.93e-28
Family Ribonuclease PH domain 2-like 0.00088
Further Details:      
 
Domain Number 5 Region: 556-641
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.18e-24
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 
Domain Number 6 Region: 615-693
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.29e-21
Family Cold shock DNA-binding domain-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 205918.Psyr_4176
Sequence length 701
Comment (Pseudomonas syringae pv B728a)
Sequence
MNPVIKKFQFGQSTVTLETGRIARQASGAVLVTVDDDVSVLVTVVGAKQADAGKGFFPLS
VHYQEKTYAAGKIPGGFFKREGRPSEKETLTSRLIDRPIRPLFPEGFMNEVQVVCTVVST
SKKIDPDIAAMIGTSAALAISGIPFDGPVGAARVAFHESTGYLLNPTYEQLQASSLDMVV
AGTSEAVLMVESEAKELTEDQMLGAVLFAHDEFQVVINAIKELAAEAAKPTWDWQPKPEA
TALLGAIRAEFGDAISQAYTITVKADRYARLGELKDQVVAKLAVEDGSPSASEVKAAFGE
IEYRTVRENIVNGKPRIDGRDTRTVRPLNIEVGVLPKTHGSALFTRGETQALVVATLGTA
RDAQLLDTLEGEKKDPFMLHYNFPPFSVGECGRMGGAGRREIGHGRLARRSVQAMLPGAD
VFPYTIRVVSEITESNGSSSMASVCGASLALMDAGVPMKAPVAGIAMGLVKEGEKFAILT
DILGDEDHLGDMDFKVAGTSKGVTALQMDIKIKGITEEIMEIALGQALEARLNILGQMNQ
IIGQSRNELSANAPTMIAMKIDTDKIRDVIGKGGATIRAICEETKASIDIEDDGSIKIFG
ESKEAAEAARQRVLGITAEAEIGKIYIGKVERIVDFGAFVNILPGKDGLVHISMLSDARV
EKVTDILKEGQEVEVLVLDVDNRGRIKLSIKDVAAAKASGV
Download sequence
Identical sequences A0A0P9ZJT6 Q4ZNR6
WP_011268879.1.19481 YP_237244.1.68675 205918.Psyr_4176 gi|66047403|ref|YP_237244.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]