SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 205918.Psyr_4490 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  205918.Psyr_4490
Domain Number 1 Region: 77-238
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 2.68e-30
Family D-ribose-5-phosphate isomerase (RpiA), catalytic domain 0.045
Further Details:      
 
Domain Number 2 Region: 5-44
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000726
Family Biotin repressor-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 205918.Psyr_4490
Sequence length 254
Comment (Pseudomonas syringae pv B728a)
Sequence
MDVKKTDRIKQIQQALQDQKAIHLREMAALLDVSEMTLRRDLSRHPERLRLLGGYITRAH
DDPEPGDYRVSEQGTRHVEEKRRIGKLAATFIQPGDTVFFDCGTTIPFVVDFIPDELEFT
AVCNSLNVLLKLQQKPNCSIVLCGGMFHRKNQVFESHAETSILDGVRLTWAFVSAAGVSL
DCGVTCFNLHEVEVKQKVMRQARQSLLLADHSKFDAVRTAHFGALSDFHCVVSDKKIPRS
YREAIEAGGAQLVL
Download sequence
Identical sequences Q4ZMV2
205918.Psyr_4490 WP_011269065.1.19481 WP_011269065.1.19682 WP_011269065.1.49784 WP_011269065.1.58699 WP_011269065.1.92003 YP_237558.1.68675 gi|66047717|ref|YP_237558.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]