SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 205920.ECH_0478 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  205920.ECH_0478
Domain Number 1 Region: 57-160
Classification Level Classification E-value
Superfamily Acid proteases 1.13e-21
Family Retroviral protease (retropepsin) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 205920.ECH_0478
Sequence length 172
Comment (Ehrlichia chaffeensis Arkansas)
Sequence
MRNVKYVLFWLGFIVLVMLFSGTKDDIGGNKYFNKFFPNAATQNNKVNYVEGGVEFYRAK
DGHFYIEAMIHGIPVNFLVDTGATDVVLSVEDAKRLKHHLKYLNKKKTYHTANGTVKALY
VEISEMQVGKFVVNNVKASVNVSPMRTSLLGMSFLQYFHFNMSGDKLTLHSY
Download sequence
Identical sequences Q2GGY9
WP_011452628.1.20904 WP_011452628.1.31359 WP_011452628.1.42435 WP_011452628.1.42678 WP_011452628.1.56909 WP_011452628.1.68154 WP_011452628.1.89020 WP_011452628.1.91245 205920.ECH_0478 gi|88658231|ref|YP_507294.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]