SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 205920.ECH_0726 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  205920.ECH_0726
Domain Number 1 Region: 299-492
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.87e-47
Family Ribonuclease PH domain 1-like 0.0000348
Further Details:      
 
Domain Number 2 Region: 2-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.58e-44
Family Ribonuclease PH domain 1-like 0.0000762
Further Details:      
 
Domain Number 3 Region: 454-551
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.14e-27
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 
Domain Number 4 Region: 559-643
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.06e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 5 Region: 140-240
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.01e-22
Family Ribonuclease PH domain 2-like 0.0055
Further Details:      
 
Domain Number 6 Region: 624-701
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.21e-19
Family Cold shock DNA-binding domain-like 0.0012
Further Details:      
 
Domain Number 7 Region: 241-324
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000000000889
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 205920.ECH_0726
Sequence length 796
Comment (Ehrlichia chaffeensis Arkansas)
Sequence
MFNLIRRSAEWGGKTLVLESGKIARQASGAVMVSYAGTTVLATVVTGKTKEPVDFLPLTV
QFVAKSYAVGKIPGGFLKREGKPSDRETLISRLIDRSIRPLFPAGFYDEISIVCNLLSYD
TVTPPEVTALVGATAALSISGVPFNGLVVGARVGYLPSEGKYLLNASADEMLCSSLDLFL
SGNEDSVLMVESEASELSESQMLGAITFGHQHCQEVINLIKEFSHESGQTPIDFIPHDIS
SLVSDIESSYKEDFSLAYSNTIKKERVLKLEELRGKVLSEVADKYSAGDVECSDQDIVTA
LKTFERSLVRSKIIDTSSRIDGRAFDEIRDIEIEVDVLPKAHGSALFTRGNTQALVVTAL
GTPQDEQIVDDLDGDRRENFLLHYNFPPYAVGESAALRAPGRREIGHGKLAWRAIRYVLP
EKSDFPYTIRVVSEITESDGSSSMATVCGASLALMDTGVPIKSPVAGIAMGLIKEDDRFI
ILSDILGDEDHLGDMDFKVAGTAEGVTALQMDMKISGIDIDIIEKALLQAKDGRMHILSK
MNAVIQESRNRIKNHAPRIESIFINKDKIRNVIGSGGKNIRDICEKTGAKIEIIQDGTVM
IYAVNNEAVEYAKSMIMDIVTEPEIGKVFEGTVVEIMKFGAFVSFLGGKKGLVHISEIRN
EHISSVGSVISLNDKVKVLVIGIDREHIQLSMRRVDQESGEPIDGELYNIRKNSFSDDSC
GSTGGSSFKESYNPNSRHGSHEKKRSGGSSRSSRRNSNGPNYYREDLPSSNGFGNNNRSF
SNSRNGHDVPRKPRFF
Download sequence
Identical sequences Q2GGA4
WP_011452780.1.20904 WP_011452780.1.31359 WP_011452780.1.42435 WP_011452780.1.42678 WP_011452780.1.56909 WP_011452780.1.68154 WP_011452780.1.89020 WP_011452780.1.91245 205920.ECH_0726 gi|88658296|ref|YP_507529.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]