SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 205921.SAK_0266 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  205921.SAK_0266
Domain Number 1 Region: 9-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.59e-45
Family Ribonuclease PH domain 1-like 0.0000328
Further Details:      
 
Domain Number 2 Region: 297-490
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.54e-43
Family Ribonuclease PH domain 1-like 0.00000876
Further Details:      
 
Domain Number 3 Region: 143-233
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.5e-28
Family Ribonuclease PH domain 2-like 0.002
Further Details:      
 
Domain Number 4 Region: 453-550
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 7.46e-28
Family Ribonuclease PH domain 2-like 0.0000813
Further Details:      
 
Domain Number 5 Region: 613-697
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.83e-20
Family Cold shock DNA-binding domain-like 0.00095
Further Details:      
 
Domain Number 6 Region: 555-632
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000137
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Domain Number 7 Region: 236-323
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000000000523
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 205921.SAK_0266
Sequence length 709
Comment (Streptococcus agalactiae A909)
Sequence
MSKQVFEMIFAGKKLVVETGQVAKQANGSVVVRYGDSTVLTAAVMSKKMSTGDFFPLQVN
YEEKMYAAGKFPGGFNKREGRPSTDATLTARLIDRPIRPMFAEGFRNEVQVINTVLSFDE
NASAPMAAMFGSSLALSISDIPFNGPIAGVQVAYVDGNFIINPTAQEQEASALELTVAGT
KEAINMVESGAKELSEEIMLEALLKGHEAVCELIAFQEEIVTAIGKEKAEVELLQVDPEL
QAEIIATHNIALQAAVQVEEKKAREAATEAVKEVVIGEYEARYAEHEEYDRIMRDVAEIL
EQMEHAEVRRLITEDKIRPDGRRVDEIRPLDAEIDFLPQVHGSGLFTRGQTQALSVLTLA
PMGEAQIIDGLTPEYKKRFMHHYNFPQYSVGETGRYGAAGRREIGHGALGERALEQVLPS
LEEFPYAIRLVAEVLESNGSSSQASICAGTLALMAGGVPIKAPVAGIAMGLISDGTNYTV
LTDIQGLEDHFGDMDFKVAGTREGITALQMDIKIEGITPQILEEALAQAKKARFEILDVL
HGAIAEPRPQLAPTAPKIDMIKIDVDKIKVVIGKGGETIDKIIAETGVKIDIDEEGNVSI
FSSDQAAIDRTKDIIASLVREAKVGEVYHAKVVRIEKFGAFVNLFDKTDALVHISEIAWT
RTANVADVLEIGEEVDVKVIKIDDKGRVDASMKALLPRPPKADNPKKES
Download sequence
Identical sequences A0A0E1EEY9 Q3K3G9
gi|512538441|ref|YP_008083945.1| 205921.SAK_0266 gi|76788173|ref|YP_328934.1| WP_000043850.1.100254 WP_000043850.1.10029 WP_000043850.1.100367 WP_000043850.1.100766 WP_000043850.1.101222 WP_000043850.1.101267 WP_000043850.1.101296 WP_000043850.1.101830 WP_000043850.1.101853 WP_000043850.1.101864 WP_000043850.1.101956 WP_000043850.1.10371 WP_000043850.1.10618 WP_000043850.1.10723 WP_000043850.1.10924 WP_000043850.1.11465 WP_000043850.1.12166 WP_000043850.1.1251 WP_000043850.1.12619 WP_000043850.1.12688 WP_000043850.1.12755 WP_000043850.1.12978 WP_000043850.1.13064 WP_000043850.1.13285 WP_000043850.1.13384 WP_000043850.1.13737 WP_000043850.1.14275 WP_000043850.1.14324 WP_000043850.1.1437 WP_000043850.1.14738 WP_000043850.1.14953 WP_000043850.1.14960 WP_000043850.1.15417 WP_000043850.1.15526 WP_000043850.1.15556 WP_000043850.1.16134 WP_000043850.1.16165 WP_000043850.1.16342 WP_000043850.1.16535 WP_000043850.1.17339 WP_000043850.1.17489 WP_000043850.1.1760 WP_000043850.1.1775 WP_000043850.1.18047 WP_000043850.1.18425 WP_000043850.1.18450 WP_000043850.1.18829 WP_000043850.1.18841 WP_000043850.1.18933 WP_000043850.1.19892 WP_000043850.1.20123 WP_000043850.1.20188 WP_000043850.1.20326 WP_000043850.1.20791 WP_000043850.1.20847 WP_000043850.1.21522 WP_000043850.1.21525 WP_000043850.1.21669 WP_000043850.1.21722 WP_000043850.1.22139 WP_000043850.1.22801 WP_000043850.1.23380 WP_000043850.1.23384 WP_000043850.1.24441 WP_000043850.1.24475 WP_000043850.1.24845 WP_000043850.1.25781 WP_000043850.1.25998 WP_000043850.1.26029 WP_000043850.1.26056 WP_000043850.1.26300 WP_000043850.1.2651 WP_000043850.1.26791 WP_000043850.1.26827 WP_000043850.1.27024 WP_000043850.1.2754 WP_000043850.1.27583 WP_000043850.1.27880 WP_000043850.1.27958 WP_000043850.1.28021 WP_000043850.1.29020 WP_000043850.1.29163 WP_000043850.1.29238 WP_000043850.1.29352 WP_000043850.1.29719 WP_000043850.1.29888 WP_000043850.1.30062 WP_000043850.1.30252 WP_000043850.1.30603 WP_000043850.1.30703 WP_000043850.1.3074 WP_000043850.1.3112 WP_000043850.1.3166 WP_000043850.1.31888 WP_000043850.1.32520 WP_000043850.1.32745 WP_000043850.1.32818 WP_000043850.1.33723 WP_000043850.1.34227 WP_000043850.1.34276 WP_000043850.1.34467 WP_000043850.1.34475 WP_000043850.1.34896 WP_000043850.1.34906 WP_000043850.1.35216 WP_000043850.1.35428 WP_000043850.1.35443 WP_000043850.1.36095 WP_000043850.1.36977 WP_000043850.1.37018 WP_000043850.1.37098 WP_000043850.1.37523 WP_000043850.1.37570 WP_000043850.1.38578 WP_000043850.1.38699 WP_000043850.1.3880 WP_000043850.1.38842 WP_000043850.1.38910 WP_000043850.1.39386 WP_000043850.1.40015 WP_000043850.1.40203 WP_000043850.1.40359 WP_000043850.1.41269 WP_000043850.1.41399 WP_000043850.1.41646 WP_000043850.1.41663 WP_000043850.1.41785 WP_000043850.1.4215 WP_000043850.1.42225 WP_000043850.1.42844 WP_000043850.1.43199 WP_000043850.1.44371 WP_000043850.1.44374 WP_000043850.1.44712 WP_000043850.1.44727 WP_000043850.1.44746 WP_000043850.1.44957 WP_000043850.1.45 WP_000043850.1.45103 WP_000043850.1.45150 WP_000043850.1.45540 WP_000043850.1.45790 WP_000043850.1.45896 WP_000043850.1.45976 WP_000043850.1.46116 WP_000043850.1.46992 WP_000043850.1.48052 WP_000043850.1.49082 WP_000043850.1.49421 WP_000043850.1.49423 WP_000043850.1.49508 WP_000043850.1.49888 WP_000043850.1.50326 WP_000043850.1.5055 WP_000043850.1.50874 WP_000043850.1.51102 WP_000043850.1.51114 WP_000043850.1.51570 WP_000043850.1.51780 WP_000043850.1.52273 WP_000043850.1.52470 WP_000043850.1.52634 WP_000043850.1.52729 WP_000043850.1.52826 WP_000043850.1.52916 WP_000043850.1.52981 WP_000043850.1.53087 WP_000043850.1.54228 WP_000043850.1.54416 WP_000043850.1.54423 WP_000043850.1.5451 WP_000043850.1.54629 WP_000043850.1.54752 WP_000043850.1.54818 WP_000043850.1.54821 WP_000043850.1.55451 WP_000043850.1.55655 WP_000043850.1.55753 WP_000043850.1.564 WP_000043850.1.56404 WP_000043850.1.56602 WP_000043850.1.56930 WP_000043850.1.57174 WP_000043850.1.57262 WP_000043850.1.57407 WP_000043850.1.57557 WP_000043850.1.57586 WP_000043850.1.57900 WP_000043850.1.58075 WP_000043850.1.58254 WP_000043850.1.59040 WP_000043850.1.59057 WP_000043850.1.59460 WP_000043850.1.5977 WP_000043850.1.5999 WP_000043850.1.60159 WP_000043850.1.60593 WP_000043850.1.60702 WP_000043850.1.61267 WP_000043850.1.61458 WP_000043850.1.61676 WP_000043850.1.61844 WP_000043850.1.62057 WP_000043850.1.62267 WP_000043850.1.62362 WP_000043850.1.62758 WP_000043850.1.6321 WP_000043850.1.63363 WP_000043850.1.63367 WP_000043850.1.63482 WP_000043850.1.63980 WP_000043850.1.64206 WP_000043850.1.64297 WP_000043850.1.64352 WP_000043850.1.64459 WP_000043850.1.64468 WP_000043850.1.64713 WP_000043850.1.64967 WP_000043850.1.64975 WP_000043850.1.65195 WP_000043850.1.65297 WP_000043850.1.65323 WP_000043850.1.6564 WP_000043850.1.65668 WP_000043850.1.66063 WP_000043850.1.66242 WP_000043850.1.67162 WP_000043850.1.67318 WP_000043850.1.67444 WP_000043850.1.67476 WP_000043850.1.67759 WP_000043850.1.68290 WP_000043850.1.6840 WP_000043850.1.68443 WP_000043850.1.68587 WP_000043850.1.68732 WP_000043850.1.68788 WP_000043850.1.68827 WP_000043850.1.69023 WP_000043850.1.69077 WP_000043850.1.69101 WP_000043850.1.69132 WP_000043850.1.69163 WP_000043850.1.6986 WP_000043850.1.70219 WP_000043850.1.70276 WP_000043850.1.70286 WP_000043850.1.70391 WP_000043850.1.70397 WP_000043850.1.70932 WP_000043850.1.71044 WP_000043850.1.71237 WP_000043850.1.71554 WP_000043850.1.71606 WP_000043850.1.71709 WP_000043850.1.7191 WP_000043850.1.7234 WP_000043850.1.72381 WP_000043850.1.72464 WP_000043850.1.72821 WP_000043850.1.73082 WP_000043850.1.73137 WP_000043850.1.73417 WP_000043850.1.73449 WP_000043850.1.73585 WP_000043850.1.73637 WP_000043850.1.73692 WP_000043850.1.73696 WP_000043850.1.73856 WP_000043850.1.74188 WP_000043850.1.74717 WP_000043850.1.74933 WP_000043850.1.74951 WP_000043850.1.75020 WP_000043850.1.75077 WP_000043850.1.75293 WP_000043850.1.7586 WP_000043850.1.75882 WP_000043850.1.76034 WP_000043850.1.7620 WP_000043850.1.76408 WP_000043850.1.76610 WP_000043850.1.76906 WP_000043850.1.76996 WP_000043850.1.77757 WP_000043850.1.77945 WP_000043850.1.78006 WP_000043850.1.78251 WP_000043850.1.78292 WP_000043850.1.78464 WP_000043850.1.7882 WP_000043850.1.79474 WP_000043850.1.79724 WP_000043850.1.80180 WP_000043850.1.80460 WP_000043850.1.80706 WP_000043850.1.81080 WP_000043850.1.81115 WP_000043850.1.81303 WP_000043850.1.81506 WP_000043850.1.82293 WP_000043850.1.82501 WP_000043850.1.82730 WP_000043850.1.83071 WP_000043850.1.83198 WP_000043850.1.8340 WP_000043850.1.83465 WP_000043850.1.8362 WP_000043850.1.84093 WP_000043850.1.84119 WP_000043850.1.84227 WP_000043850.1.84273 WP_000043850.1.84289 WP_000043850.1.84343 WP_000043850.1.85179 WP_000043850.1.852 WP_000043850.1.85296 WP_000043850.1.85914 WP_000043850.1.85966 WP_000043850.1.8625 WP_000043850.1.86532 WP_000043850.1.86535 WP_000043850.1.87011 WP_000043850.1.87307 WP_000043850.1.87395 WP_000043850.1.87807 WP_000043850.1.87880 WP_000043850.1.87882 WP_000043850.1.88071 WP_000043850.1.88296 WP_000043850.1.88344 WP_000043850.1.887 WP_000043850.1.89132 WP_000043850.1.89248 WP_000043850.1.89336 WP_000043850.1.89477 WP_000043850.1.89574 WP_000043850.1.89608 WP_000043850.1.90068 WP_000043850.1.90074 WP_000043850.1.90214 WP_000043850.1.90411 WP_000043850.1.90664 WP_000043850.1.90867 WP_000043850.1.91002 WP_000043850.1.91223 WP_000043850.1.91285 WP_000043850.1.9136 WP_000043850.1.91673 WP_000043850.1.91731 WP_000043850.1.92219 WP_000043850.1.92320 WP_000043850.1.92547 WP_000043850.1.92590 WP_000043850.1.92647 WP_000043850.1.9295 WP_000043850.1.93080 WP_000043850.1.93303 WP_000043850.1.93323 WP_000043850.1.93537 WP_000043850.1.93793 WP_000043850.1.9386 WP_000043850.1.93881 WP_000043850.1.93884 WP_000043850.1.94346 WP_000043850.1.94532 WP_000043850.1.94803 WP_000043850.1.94973 WP_000043850.1.95950 WP_000043850.1.96087 WP_000043850.1.96406 WP_000043850.1.96868 WP_000043850.1.96943 WP_000043850.1.9711 WP_000043850.1.9741 WP_000043850.1.97621 WP_000043850.1.97836 WP_000043850.1.97850 WP_000043850.1.98063 WP_000043850.1.9822 WP_000043850.1.98370 WP_000043850.1.98773 WP_000043850.1.98979 WP_000043850.1.99017 WP_000043850.1.99019 WP_000043850.1.99056 WP_000043850.1.99241 WP_000043850.1.99286 WP_000043850.1.99447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]