SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 205922.Pfl01_0783 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  205922.Pfl01_0783
Domain Number 1 Region: 296-489
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.3e-50
Family Ribonuclease PH domain 1-like 0.0000177
Further Details:      
 
Domain Number 2 Region: 3-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.06e-47
Family Ribonuclease PH domain 1-like 0.0000189
Further Details:      
 
Domain Number 3 Region: 451-549
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.79e-28
Family Ribonuclease PH domain 2-like 0.00014
Further Details:      
 
Domain Number 4 Region: 145-236
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.24e-27
Family Ribonuclease PH domain 2-like 0.001
Further Details:      
 
Domain Number 5 Region: 556-641
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.42e-24
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 
Domain Number 6 Region: 615-693
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.36e-21
Family Cold shock DNA-binding domain-like 0.00016
Further Details:      
 
Domain Number 7 Region: 241-322
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 3.66e-16
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 205922.Pfl01_0783
Sequence length 701
Comment (Pseudomonas fluorescens Pf0 1)
Sequence
MNPVIKKFQFGQSTVTLETGRIARQASGAVLVTVDDDVSVLVTVVGAKQADPGKGFFPLS
VHYQEKTYAAGKIPGGFFKREGRPSEKETLTSRLIDRPIRPLFPEGFMNEVQVVCTVVST
SKKTDPDIAAMIGTSAALAISGIPFDGPIGAARVAFHESTGYLLNPTYEQQAASSLDMVV
AGTSDAVLMVESEAKELTEDQMLGAVLFAHDEFQVVINAVKELAAEAAKPTWTWAPAPEA
TELLAAIRSEFGEAISQAYTITIKADRYARLGELRDQVVAKLSGEEGQPSAADVKAAFGE
IEYRTVRENIVNGKPRIDGRDTRTVRPLNIEVGVLPKTHGSALFTRGETQALVVATLGTA
RDAQLLDTLEGEKKDPFMLHYNFPPFSVGECGRMGGAGRREIGHGRLARRSVSAMLPAAD
VFPYTIRVVSEITESNGSSSMASVCGASLALMDAGVPMKAPVAGIAMGLVKEGEKFAVLT
DILGDEDHLGDMDFKVAGTAKGVTALQMDIKIKGITEEIMEIALGQALEARLNILGQMNQ
IIGQSRTELSANAPTMIAMKIDTDKIRDVIGKGGATIRAICEETKASIDIEDDGSIKIFG
ETKEAAEAARQRVLGITAEAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISMLSDARV
EKVTDILKEGQEVEVLVLDVDNRGRIKLSIKDVAAAKASGV
Download sequence
Identical sequences A0A0C1WT89 A0A173IWG9 A0A1G5MLG9 A0A1G6F440 A0A2K4HT34 Q3KI80
gi|77457010|ref|YP_346515.1| 205922.Pfl01_0783 WP_011332410.1.15864 WP_011332410.1.20937 WP_011332410.1.22023 WP_011332410.1.2668 WP_011332410.1.30523 WP_011332410.1.32803 WP_011332410.1.38776 WP_011332410.1.46399 WP_011332410.1.47897 WP_011332410.1.51676 WP_011332410.1.53106 WP_011332410.1.54387 WP_011332410.1.54700 WP_011332410.1.55771 WP_011332410.1.58385 WP_011332410.1.58965 WP_011332410.1.62013 WP_011332410.1.64081 WP_011332410.1.6588 WP_011332410.1.72974 WP_011332410.1.75567 WP_011332410.1.84829 WP_011332410.1.85257 WP_011332410.1.91175 WP_011332410.1.91687 WP_011332410.1.91867 WP_011332410.1.96080 WP_011332410.1.98588 WP_011332410.1.9973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]