SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 205922.Pfl01_1565 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  205922.Pfl01_1565
Domain Number 1 Region: 37-261
Classification Level Classification E-value
Superfamily Chemotaxis phosphatase CheZ 2.09e-60
Family Chemotaxis phosphatase CheZ 0.0000489
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 205922.Pfl01_1565
Sequence length 262
Comment (Pseudomonas fluorescens Pf0 1)
Sequence
MEHNESSQGDFESTLKKHAVELVESLEKGKFGDAVQLIHELNQTRDRGLYQEVGKLTREL
HSAIVNFQIDPHMPQAEEVSQITDATERLGYVVKLTEAAANRTMDLVESATPVVNGLADE
AQALSADWGRFMRREVGAEEFRELARRVDGFLARSSADNRAVSSNLNDILLAQDYQDLTG
QVIKRVTQLVTEVESNLLKLVLMASQVDRFAGIEHDRAAMLAEKDPQKHLSQGEGPQIHA
DKREDVVSGQDDVDDLLSSLGF
Download sequence
Identical sequences A0A0C1ZMM0 A0A173J0M4 A0A1G5MSF1 A0A1G6A3J2 A0A2K4HSK9 Q3KFZ8
205922.Pfl01_1565 gi|77457792|ref|YP_347297.1| WP_011333071.1.20937 WP_011333071.1.2668 WP_011333071.1.38776 WP_011333071.1.51676 WP_011333071.1.54387 WP_011333071.1.54700 WP_011333071.1.55771 WP_011333071.1.58385 WP_011333071.1.62013 WP_011333071.1.64081 WP_011333071.1.6588 WP_011333071.1.72974 WP_011333071.1.75567 WP_011333071.1.84829 WP_011333071.1.91175 WP_011333071.1.91687 WP_011333071.1.91867 WP_011333071.1.98588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]