SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 205922.Pfl01_2498 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  205922.Pfl01_2498
Domain Number 1 Region: 135-324
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.4e-29
Family Laminin G-like module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 205922.Pfl01_2498
Sequence length 599
Comment (Pseudomonas fluorescens Pf0 1)
Sequence
MQRLFLSLLICLGFVLPATAQAWWQDDWHYRKQIAVDTTPQGAAINQALGRTALLVRLHT
GNFTFDGVKEDGSDLRFVAADDKTVLNHQIESFDALMGMAQIWVDVPNVEGGQRQDIWMY
YGNQKAPATGNGQLTLDPNYTALYHFDGATGTPAKDTTAYGNTAQSATGAAIDGVVGRAL
QFSGQPLLLPASPSLQHNAGSAFTFSAWLRLDQANGEQLILARREGANSLLVGVNQGVPF
VDIDGQRAVATQPLNPGQWQHVALTAEGAKVTLYINGRESAALAQAMPAFNSVMAIGADL
HEGPFQPFVGAIDELRLSKVARPAPLLLADATSQGAESKLVAYGVDEEQSGFGFGSLGFL
LNAVPVDAWVIIAVLVLMMFQSWIIMLRKNRTLSRVTAANEDFRVQFAKVGTRLEMFADD
TQLAQRLQHSSLWRLYLVAVKEIRTRREQGADTSSVSAATIEAIRCSMDGVRTRENQQLS
SKLSTLSNAIAGGPYIGLLGTVLGIMVVFLGTAMAGDVNINAIAPGMAAALLATAMGLFV
AIPALFGYNRLITRNKEVSADMRVFVDEFITRLAEMHGEGQSSEAAHQRGHHANQSVPA
Download sequence
Identical sequences Q3KDB6
205922.Pfl01_2498 gi|77458723|ref|YP_348229.1| WP_011333918.1.2668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]