SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 206672.BL1544 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  206672.BL1544
Domain Number 1 Region: 54-343
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 1.86e-46
Family alpha-L-arabinanase-like 0.00015
Further Details:      
 
Domain Number 2 Region: 567-804
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.31e-31
Family Beta-D-xylosidase C-terminal domain-like 0.0085
Further Details:      
 
Domain Number 3 Region: 402-559
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.59e-23
Family CBM22 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 206672.BL1544
Sequence length 958
Comment (Bifidobacterium longum)
Sequence
MNYLRQKISASAIAVLSTCGLILAPMPVFADDSTPSSTPSDGSYTTTDSGDGTYSIPMLN
TDVPDISVIRVSKDDPNNKDGRDVYYMVSTTMELSPGSPIMKSYDLVNWWIVTYVYDRIS
MSDASSLRNGASSYGEGEWAPSLRYHNGRFYVLFNTNNLNGAYIYYTDDIENGPWTKIAL
NRGFHDPSLYFDEQGSPWIISGVNQYRLSDDLTTVVESHENIISAEQFTDDLGETPTGFE
GSQTFKIGDYFYTPTIYWGKDGRTVMLLRTTDLLDGSKYEAKKYYLGAFAQGSLVEVDNG
DGTTSWHGFFFRDTYPTGRIPGLIPATWGDDGWPVFGDNNQVSASDTYDKLIDLPADLEN
LVRQRSLVNSDDFDNDAPHQSYQDQDWWTLEEPPQVDDSLIGIELVDNGDFENGTESWTP
QWNGTLTAITDGSLSGTTSLAVTNRGEYNGAGPGQSMDGKLQQGVTYRASATIRYDHEMD
GVDSSAVTSHLFYVAIQYADGTINRVATGTVKRGETTTITGEFSIPSDANVEGSKLIVET
AWGAEGTCMDYVIDDISLIGLADEKEYPVAEEYQPNGSNLDLVWEWGHNPDNRYWSLTDR
EGWLRLTNGHKVSATAKYMKGTYGDLTYFETARNVLSQRTFGGSMSVETHMDVSHMKDGD
TAGLATYTRSFAYAAVRQENGQRTLGVVKRVYDNGVKDADGNIVDDTIDRDAEEAFVSGG
TVTLPDDATNVWIKSDNTLDNASGKLTIQYWYSLDGKQWSKLGDEQGPLTYDWSLSHFKG
YRIGLFNYAKENTGGYVDFDYYDLSDVLTSDGKAVDTSKLRSAIDQADSLQSAEYPMDEW
DKMLTLLDKAKQALASDPSTQNEVDAPQRALSLQLAQLAVDRQSGDGGNPGGGDQTGDGN
QSGNGDQTGDGGQQQSSTADDNSSELSSTGSSVTPMVLSAIALMLAGISVIRIRRSSR
Download sequence
Identical sequences C5ED46 Q8G450 U6E8A6
gi|23466096|ref|NP_696699.1| NP_696699.1.18194 WP_007052995.1.10685 WP_007052995.1.22978 WP_007052995.1.23590 WP_007052995.1.26381 WP_007052995.1.37185 WP_007052995.1.46548 WP_007052995.1.50944 WP_007052995.1.51274 WP_007052995.1.55246 WP_007052995.1.55537 WP_007052995.1.59950 WP_007052995.1.62466 WP_007052995.1.76144 WP_007052995.1.76388 WP_007052995.1.80315 WP_007052995.1.89707 WP_007052995.1.94713 WP_007052995.1.98685 WP_007052995.1.99105 WP_007052995.1.99722 206672.BL1544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]