SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 208435.SAG1691 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  208435.SAG1691
Domain Number 1 Region: 27-341
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 1.86e-89
Family Glycosyl hydrolases family 32 N-terminal domain 0.0000188
Further Details:      
 
Domain Number 2 Region: 341-478
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-25
Family Glycosyl hydrolases family 32 C-terminal domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 208435.SAG1691
Sequence length 479
Comment (Streptococcus agalactiae 2603)
Sequence
MNLPTEIRYRPYDEWTEEDKENIVKNVSKSPWRATYHLEAKTGLLNDPNGFSYFNGKFHL
FYQNWPFGAAHGLKQWVHTESDDLVHFKETGIKLKPDHVNDSHGAYSGSALAIDDKLFLF
YTGNVRDMKWNRDPRQIGAWMTNDGKITKFDKVLISQPNDVTEHFRDPQIFNYDNQFYAV
IGAQNSKKCGFIKLYKALNNDIHHWEFVGDLDFGGTGSEYMIECPNIIFVKGKPVLLYSP
QGLDKNELDYQNIYPNTYKIGQYFDANSSKIVEPSPIYNLDYGFEAYATQGFNTSDGRAF
IVSWIGLPDIDYPSDQFDYQGAMSLVKELSIKNGNLYQYPVPAMKNLRQHQAEFKTQLQT
NNTYELELLVPRNDLSSFVLFANPKGQGLSITIDTVKGKVIIDRSQAGQQYATEFGTSRQ
CDIPKDATSINIFIDKSIFEIFINKGEKVFTGRVFPDAEQSGIQLKEGHVHGKYFELKY
Download sequence
Identical sequences A0A0H1CG04 A0A1F0CFW3 Q8DY03
NP_688682.1.71890 WP_001053051.1.100037 WP_001053051.1.100254 WP_001053051.1.100766 WP_001053051.1.101222 WP_001053051.1.101267 WP_001053051.1.101956 WP_001053051.1.10371 WP_001053051.1.10618 WP_001053051.1.11465 WP_001053051.1.11756 WP_001053051.1.12166 WP_001053051.1.12755 WP_001053051.1.12978 WP_001053051.1.13008 WP_001053051.1.13064 WP_001053051.1.13384 WP_001053051.1.13553 WP_001053051.1.13737 WP_001053051.1.14429 WP_001053051.1.15417 WP_001053051.1.15526 WP_001053051.1.16134 WP_001053051.1.16535 WP_001053051.1.16706 WP_001053051.1.1760 WP_001053051.1.18047 WP_001053051.1.18450 WP_001053051.1.18841 WP_001053051.1.18933 WP_001053051.1.19892 WP_001053051.1.19950 WP_001053051.1.20188 WP_001053051.1.21525 WP_001053051.1.22004 WP_001053051.1.22247 WP_001053051.1.22801 WP_001053051.1.23380 WP_001053051.1.24441 WP_001053051.1.24475 WP_001053051.1.25998 WP_001053051.1.26056 WP_001053051.1.26258 WP_001053051.1.26300 WP_001053051.1.26357 WP_001053051.1.26791 WP_001053051.1.27880 WP_001053051.1.29020 WP_001053051.1.29163 WP_001053051.1.29238 WP_001053051.1.29352 WP_001053051.1.30200 WP_001053051.1.30603 WP_001053051.1.30703 WP_001053051.1.30710 WP_001053051.1.3074 WP_001053051.1.30831 WP_001053051.1.31888 WP_001053051.1.32728 WP_001053051.1.32745 WP_001053051.1.34276 WP_001053051.1.34467 WP_001053051.1.34475 WP_001053051.1.34906 WP_001053051.1.35216 WP_001053051.1.35443 WP_001053051.1.36095 WP_001053051.1.36408 WP_001053051.1.36726 WP_001053051.1.36878 WP_001053051.1.3691 WP_001053051.1.36977 WP_001053051.1.37523 WP_001053051.1.37570 WP_001053051.1.38910 WP_001053051.1.3937 WP_001053051.1.39386 WP_001053051.1.3963 WP_001053051.1.41269 WP_001053051.1.41399 WP_001053051.1.41646 WP_001053051.1.41663 WP_001053051.1.41785 WP_001053051.1.42225 WP_001053051.1.42844 WP_001053051.1.4323 WP_001053051.1.44727 WP_001053051.1.44746 WP_001053051.1.44957 WP_001053051.1.45 WP_001053051.1.45103 WP_001053051.1.45150 WP_001053051.1.45790 WP_001053051.1.45976 WP_001053051.1.47485 WP_001053051.1.48239 WP_001053051.1.49082 WP_001053051.1.49278 WP_001053051.1.49423 WP_001053051.1.49508 WP_001053051.1.49888 WP_001053051.1.5055 WP_001053051.1.50639 WP_001053051.1.51102 WP_001053051.1.51114 WP_001053051.1.51570 WP_001053051.1.51780 WP_001053051.1.52470 WP_001053051.1.52729 WP_001053051.1.54107 WP_001053051.1.54228 WP_001053051.1.5451 WP_001053051.1.54629 WP_001053051.1.54752 WP_001053051.1.54818 WP_001053051.1.54821 WP_001053051.1.55655 WP_001053051.1.56404 WP_001053051.1.56602 WP_001053051.1.56930 WP_001053051.1.57262 WP_001053051.1.57721 WP_001053051.1.57900 WP_001053051.1.58119 WP_001053051.1.58254 WP_001053051.1.59040 WP_001053051.1.59057 WP_001053051.1.59460 WP_001053051.1.59565 WP_001053051.1.5977 WP_001053051.1.5999 WP_001053051.1.60093 WP_001053051.1.60702 WP_001053051.1.61267 WP_001053051.1.61790 WP_001053051.1.61844 WP_001053051.1.62267 WP_001053051.1.62362 WP_001053051.1.63367 WP_001053051.1.63764 WP_001053051.1.64459 WP_001053051.1.64468 WP_001053051.1.64967 WP_001053051.1.65323 WP_001053051.1.65427 WP_001053051.1.65668 WP_001053051.1.66063 WP_001053051.1.67008 WP_001053051.1.67759 WP_001053051.1.67859 WP_001053051.1.68827 WP_001053051.1.69023 WP_001053051.1.69034 WP_001053051.1.69101 WP_001053051.1.69132 WP_001053051.1.69163 WP_001053051.1.6986 WP_001053051.1.70286 WP_001053051.1.70391 WP_001053051.1.70397 WP_001053051.1.70562 WP_001053051.1.70932 WP_001053051.1.71554 WP_001053051.1.71606 WP_001053051.1.71709 WP_001053051.1.72821 WP_001053051.1.73137 WP_001053051.1.73439 WP_001053051.1.73449 WP_001053051.1.73585 WP_001053051.1.73692 WP_001053051.1.73856 WP_001053051.1.74717 WP_001053051.1.74933 WP_001053051.1.7586 WP_001053051.1.75882 WP_001053051.1.76610 WP_001053051.1.77757 WP_001053051.1.78006 WP_001053051.1.78292 WP_001053051.1.79135 WP_001053051.1.80180 WP_001053051.1.80460 WP_001053051.1.81080 WP_001053051.1.81115 WP_001053051.1.81168 WP_001053051.1.81506 WP_001053051.1.82198 WP_001053051.1.83071 WP_001053051.1.83198 WP_001053051.1.8340 WP_001053051.1.83465 WP_001053051.1.83616 WP_001053051.1.84093 WP_001053051.1.84227 WP_001053051.1.84273 WP_001053051.1.852 WP_001053051.1.85966 WP_001053051.1.8625 WP_001053051.1.86651 WP_001053051.1.87033 WP_001053051.1.87307 WP_001053051.1.87395 WP_001053051.1.87807 WP_001053051.1.87882 WP_001053051.1.887 WP_001053051.1.89248 WP_001053051.1.89303 WP_001053051.1.89336 WP_001053051.1.90019 WP_001053051.1.90074 WP_001053051.1.90530 WP_001053051.1.90666 WP_001053051.1.90941 WP_001053051.1.91002 WP_001053051.1.9136 WP_001053051.1.92184 WP_001053051.1.92547 WP_001053051.1.93080 WP_001053051.1.933 WP_001053051.1.93323 WP_001053051.1.93793 WP_001053051.1.93825 WP_001053051.1.9386 WP_001053051.1.93881 WP_001053051.1.94346 WP_001053051.1.94370 WP_001053051.1.94973 WP_001053051.1.95950 WP_001053051.1.96087 WP_001053051.1.96943 WP_001053051.1.9711 WP_001053051.1.97836 WP_001053051.1.97850 WP_001053051.1.98185 WP_001053051.1.98370 WP_001053051.1.99241 205921.SAK_1703 208435.SAG1691 gi|22537831|ref|NP_688682.1| gi|76788376|ref|YP_330305.1| gi|406710070|ref|YP_006764796.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]