SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 208435.SAG1858 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  208435.SAG1858
Domain Number - Region: 18-68
Classification Level Classification E-value
Superfamily Copper amine oxidase, domain N 0.00732
Family Copper amine oxidase, domain N 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 208435.SAG1858
Sequence length 95
Comment (Streptococcus agalactiae 2603)
Sequence
MKDENAFDGIRLEAGSTLEIYLTKNDLEHIANGYEVTLDIKPNETVNKIVIKPSFVNNIL
NPLINYDKRIVSEADLKFRDISREVARDSFALGSM
Download sequence
Identical sequences A0A1F0C5R6 Q8DXJ2
NP_688848.1.71890 WP_000651008.1.19950 WP_000651008.1.22076 WP_000651008.1.26258 WP_000651008.1.3937 WP_000651008.1.58119 WP_000651008.1.65427 WP_000651008.1.68867 WP_000651008.1.69034 WP_000651008.1.73621 WP_000651008.1.76033 WP_000651008.1.93825 WP_000651008.1.98185 208435.SAG1858 gi|22537997|ref|NP_688848.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]