SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 208963.PA14_23080 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  208963.PA14_23080
Domain Number 1 Region: 14-235
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 7.67e-54
Family NagB-like 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 208963.PA14_23080
Sequence length 238
Comment (Pseudomonas aeruginosa UCBPP-PA14)
Sequence
MAISELKLPAGVGLQVWGSAAEQARGLAAEVAGRLRSALAEQGQALLVVSGGRSPVAFLE
ALSEDQVDWSRITLSLADERWVPESHADSNAGLVRRHLLRGEAAKARFIGLYQPAASLEE
AAELADHHLHELPLPIDVLVLGMGDDGHTASLFPNSPGLDLAMDPQGTRRCLPMWAPSVP
HQRLTLPRAVLAAAKVQLLAIQGQSKLATLNTALAVEDERRMPVRAFLRAPLTIHWYP
Download sequence
Identical sequences A0A0H2ZDE4
208963.PA14_23080 WP_011666596.1.43756 gi|116051171|ref|YP_789998.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]