SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 208963.PA14_41500 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  208963.PA14_41500
Domain Number 1 Region: 2-230
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-74
Family Alginate lyase 0.00000435
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 208963.PA14_41500
Sequence length 231
Comment (Pseudomonas aeruginosa UCBPP-PA14)
Sequence
MIDLSTWNLTIPTEPTPQVITTQQLNNGYQSRYFQQGNDGGLVFWVPIDGSHTEDSTYPR
TELRETQADGSLDNWYYWQADNELRVTMSVEKVPSKNKVIIGQIHSKSPQTDDGEPLVKL
QYYYKPEEGLGRVEALVRNHPDDSYSRNVSILEQVRLGERFNYSLRVTSSGELAVRARSQ
DGEEDAYYQTLGSAWNDQLLYFKAGAYVNDNAGDSGEGSRVTIYHLNTAHR
Download sequence
Identical sequences A0A069PYU3 A0A0H2Z9V3 A0A0H3QUR8 A0A157WKT3 A0A1C7BME0 A0A1E9BT87 A0A1F0I0T4 A0A1G5LSY4 A0A1S1C096 Q9I2V8 V6AGW9 W1MKH2
gi|386059325|ref|YP_005975847.1| 208963.PA14_41500 208964.PA1784 557722.PLES_35451 gi|568154689|ref|YP_008943672.1| gi|558677642|ref|YP_008814350.1| gi|514409195|ref|YP_008132302.1| NP_250475.1.87394 WP_003087865.1.100071 WP_003087865.1.100100 WP_003087865.1.100179 WP_003087865.1.100278 WP_003087865.1.100394 WP_003087865.1.100420 WP_003087865.1.100469 WP_003087865.1.100473 WP_003087865.1.100476 WP_003087865.1.100523 WP_003087865.1.100654 WP_003087865.1.100723 WP_003087865.1.100777 WP_003087865.1.100786 WP_003087865.1.100808 WP_003087865.1.100809 WP_003087865.1.100810 WP_003087865.1.100872 WP_003087865.1.100983 WP_003087865.1.100995 WP_003087865.1.101021 WP_003087865.1.101047 WP_003087865.1.101340 WP_003087865.1.101506 WP_003087865.1.101572 WP_003087865.1.101590 WP_003087865.1.101642 WP_003087865.1.101712 WP_003087865.1.10174 WP_003087865.1.101781 WP_003087865.1.10179 WP_003087865.1.101809 WP_003087865.1.101863 WP_003087865.1.101871 WP_003087865.1.10202 WP_003087865.1.10204 WP_003087865.1.102045 WP_003087865.1.10228 WP_003087865.1.10248 WP_003087865.1.10271 WP_003087865.1.1037 WP_003087865.1.10407 WP_003087865.1.10419 WP_003087865.1.10435 WP_003087865.1.10468 WP_003087865.1.10477 WP_003087865.1.10513 WP_003087865.1.10529 WP_003087865.1.10548 WP_003087865.1.10572 WP_003087865.1.10575 WP_003087865.1.10636 WP_003087865.1.10641 WP_003087865.1.10684 WP_003087865.1.10764 WP_003087865.1.10856 WP_003087865.1.10895 WP_003087865.1.10901 WP_003087865.1.10949 WP_003087865.1.11026 WP_003087865.1.1107 WP_003087865.1.11077 WP_003087865.1.11130 WP_003087865.1.11318 WP_003087865.1.11381 WP_003087865.1.11388 WP_003087865.1.11410 WP_003087865.1.11454 WP_003087865.1.11568 WP_003087865.1.11569 WP_003087865.1.11653 WP_003087865.1.11744 WP_003087865.1.11754 WP_003087865.1.1180 WP_003087865.1.1183 WP_003087865.1.11847 WP_003087865.1.11943 WP_003087865.1.12018 WP_003087865.1.12081 WP_003087865.1.12120 WP_003087865.1.12150 WP_003087865.1.12200 WP_003087865.1.12208 WP_003087865.1.12354 WP_003087865.1.12400 WP_003087865.1.12482 WP_003087865.1.12497 WP_003087865.1.12561 WP_003087865.1.12657 WP_003087865.1.12660 WP_003087865.1.12670 WP_003087865.1.12687 WP_003087865.1.12744 WP_003087865.1.12797 WP_003087865.1.12838 WP_003087865.1.12873 WP_003087865.1.12890 WP_003087865.1.12922 WP_003087865.1.12930 WP_003087865.1.12970 WP_003087865.1.13 WP_003087865.1.13041 WP_003087865.1.1305 WP_003087865.1.13057 WP_003087865.1.13077 WP_003087865.1.13085 WP_003087865.1.13092 WP_003087865.1.13232 WP_003087865.1.13242 WP_003087865.1.13266 WP_003087865.1.13270 WP_003087865.1.13364 WP_003087865.1.13407 WP_003087865.1.13529 WP_003087865.1.13533 WP_003087865.1.1356 WP_003087865.1.1362 WP_003087865.1.13622 WP_003087865.1.13642 WP_003087865.1.13718 WP_003087865.1.13743 WP_003087865.1.13758 WP_003087865.1.13765 WP_003087865.1.13785 WP_003087865.1.13865 WP_003087865.1.14049 WP_003087865.1.14078 WP_003087865.1.14116 WP_003087865.1.14204 WP_003087865.1.14251 WP_003087865.1.14378 WP_003087865.1.14424 WP_003087865.1.14460 WP_003087865.1.14463 WP_003087865.1.14476 WP_003087865.1.14525 WP_003087865.1.14615 WP_003087865.1.14679 WP_003087865.1.14690 WP_003087865.1.14714 WP_003087865.1.1475 WP_003087865.1.14754 WP_003087865.1.14820 WP_003087865.1.14835 WP_003087865.1.14839 WP_003087865.1.14883 WP_003087865.1.14966 WP_003087865.1.15004 WP_003087865.1.1516 WP_003087865.1.152 WP_003087865.1.15231 WP_003087865.1.15281 WP_003087865.1.15297 WP_003087865.1.15328 WP_003087865.1.15373 WP_003087865.1.15408 WP_003087865.1.15474 WP_003087865.1.15480 WP_003087865.1.15482 WP_003087865.1.15485 WP_003087865.1.15602 WP_003087865.1.15666 WP_003087865.1.15886 WP_003087865.1.15889 WP_003087865.1.15934 WP_003087865.1.16074 WP_003087865.1.16109 WP_003087865.1.16197 WP_003087865.1.162 WP_003087865.1.16239 WP_003087865.1.16242 WP_003087865.1.16267 WP_003087865.1.16660 WP_003087865.1.1671 WP_003087865.1.16751 WP_003087865.1.16782 WP_003087865.1.16788 WP_003087865.1.16801 WP_003087865.1.16811 WP_003087865.1.17022 WP_003087865.1.1704 WP_003087865.1.17108 WP_003087865.1.17155 WP_003087865.1.17162 WP_003087865.1.17177 WP_003087865.1.17189 WP_003087865.1.172 WP_003087865.1.17223 WP_003087865.1.17353 WP_003087865.1.17370 WP_003087865.1.1739 WP_003087865.1.17397 WP_003087865.1.17499 WP_003087865.1.17566 WP_003087865.1.1758 WP_003087865.1.17697 WP_003087865.1.17883 WP_003087865.1.17890 WP_003087865.1.18054 WP_003087865.1.18117 WP_003087865.1.18156 WP_003087865.1.18157 WP_003087865.1.18199 WP_003087865.1.18204 WP_003087865.1.18234 WP_003087865.1.18349 WP_003087865.1.18440 WP_003087865.1.18493 WP_003087865.1.18508 WP_003087865.1.18547 WP_003087865.1.18653 WP_003087865.1.18728 WP_003087865.1.18732 WP_003087865.1.18735 WP_003087865.1.18769 WP_003087865.1.18795 WP_003087865.1.18892 WP_003087865.1.18907 WP_003087865.1.18911 WP_003087865.1.18930 WP_003087865.1.190 WP_003087865.1.19089 WP_003087865.1.19199 WP_003087865.1.19251 WP_003087865.1.19346 WP_003087865.1.19351 WP_003087865.1.19376 WP_003087865.1.1938 WP_003087865.1.19552 WP_003087865.1.19640 WP_003087865.1.19703 WP_003087865.1.19711 WP_003087865.1.19771 WP_003087865.1.19803 WP_003087865.1.19824 WP_003087865.1.19930 WP_003087865.1.19931 WP_003087865.1.20070 WP_003087865.1.2012 WP_003087865.1.20125 WP_003087865.1.20216 WP_003087865.1.20342 WP_003087865.1.20590 WP_003087865.1.20682 WP_003087865.1.20692 WP_003087865.1.20744 WP_003087865.1.20764 WP_003087865.1.20825 WP_003087865.1.20854 WP_003087865.1.20880 WP_003087865.1.20884 WP_003087865.1.20890 WP_003087865.1.209 WP_003087865.1.20978 WP_003087865.1.21002 WP_003087865.1.21039 WP_003087865.1.21100 WP_003087865.1.21166 WP_003087865.1.21209 WP_003087865.1.21242 WP_003087865.1.21349 WP_003087865.1.21358 WP_003087865.1.2144 WP_003087865.1.21448 WP_003087865.1.21460 WP_003087865.1.21471 WP_003087865.1.21517 WP_003087865.1.21607 WP_003087865.1.21718 WP_003087865.1.2172 WP_003087865.1.21767 WP_003087865.1.21782 WP_003087865.1.21801 WP_003087865.1.21863 WP_003087865.1.21871 WP_003087865.1.21891 WP_003087865.1.21932 WP_003087865.1.221 WP_003087865.1.2228 WP_003087865.1.22324 WP_003087865.1.2237 WP_003087865.1.22389 WP_003087865.1.22477 WP_003087865.1.22491 WP_003087865.1.22573 WP_003087865.1.22671 WP_003087865.1.22704 WP_003087865.1.22729 WP_003087865.1.22863 WP_003087865.1.2289 WP_003087865.1.22891 WP_003087865.1.23013 WP_003087865.1.23166 WP_003087865.1.23191 WP_003087865.1.23195 WP_003087865.1.2323 WP_003087865.1.23394 WP_003087865.1.23418 WP_003087865.1.23421 WP_003087865.1.23512 WP_003087865.1.23525 WP_003087865.1.2355 WP_003087865.1.23581 WP_003087865.1.236 WP_003087865.1.23641 WP_003087865.1.23715 WP_003087865.1.23769 WP_003087865.1.23782 WP_003087865.1.23794 WP_003087865.1.23884 WP_003087865.1.23925 WP_003087865.1.23938 WP_003087865.1.23961 WP_003087865.1.23983 WP_003087865.1.24066 WP_003087865.1.24087 WP_003087865.1.24183 WP_003087865.1.24319 WP_003087865.1.24351 WP_003087865.1.24413 WP_003087865.1.2453 WP_003087865.1.24626 WP_003087865.1.2477 WP_003087865.1.24851 WP_003087865.1.24862 WP_003087865.1.24869 WP_003087865.1.24879 WP_003087865.1.24938 WP_003087865.1.24940 WP_003087865.1.25067 WP_003087865.1.251 WP_003087865.1.25109 WP_003087865.1.25142 WP_003087865.1.25149 WP_003087865.1.25191 WP_003087865.1.25271 WP_003087865.1.2529 WP_003087865.1.2530 WP_003087865.1.25328 WP_003087865.1.25344 WP_003087865.1.25348 WP_003087865.1.25477 WP_003087865.1.25532 WP_003087865.1.25600 WP_003087865.1.25641 WP_003087865.1.25695 WP_003087865.1.2572 WP_003087865.1.25834 WP_003087865.1.25903 WP_003087865.1.2596 WP_003087865.1.25964 WP_003087865.1.26010 WP_003087865.1.261 WP_003087865.1.26301 WP_003087865.1.26334 WP_003087865.1.26428 WP_003087865.1.26463 WP_003087865.1.26473 WP_003087865.1.26489 WP_003087865.1.26539 WP_003087865.1.26553 WP_003087865.1.26592 WP_003087865.1.26604 WP_003087865.1.26682 WP_003087865.1.26740 WP_003087865.1.26816 WP_003087865.1.26862 WP_003087865.1.26967 WP_003087865.1.27018 WP_003087865.1.27107 WP_003087865.1.27211 WP_003087865.1.27259 WP_003087865.1.27288 WP_003087865.1.27505 WP_003087865.1.27534 WP_003087865.1.27549 WP_003087865.1.27587 WP_003087865.1.27687 WP_003087865.1.27738 WP_003087865.1.27783 WP_003087865.1.27837 WP_003087865.1.27858 WP_003087865.1.27933 WP_003087865.1.27966 WP_003087865.1.28006 WP_003087865.1.28057 WP_003087865.1.28064 WP_003087865.1.28078 WP_003087865.1.28136 WP_003087865.1.28193 WP_003087865.1.28258 WP_003087865.1.283 WP_003087865.1.28316 WP_003087865.1.28329 WP_003087865.1.28372 WP_003087865.1.28382 WP_003087865.1.28404 WP_003087865.1.28468 WP_003087865.1.28560 WP_003087865.1.28623 WP_003087865.1.28713 WP_003087865.1.28757 WP_003087865.1.28800 WP_003087865.1.28823 WP_003087865.1.28849 WP_003087865.1.28878 WP_003087865.1.28920 WP_003087865.1.29003 WP_003087865.1.29008 WP_003087865.1.29127 WP_003087865.1.29137 WP_003087865.1.29158 WP_003087865.1.29208 WP_003087865.1.2927 WP_003087865.1.29440 WP_003087865.1.2948 WP_003087865.1.29481 WP_003087865.1.29577 WP_003087865.1.29633 WP_003087865.1.29650 WP_003087865.1.29668 WP_003087865.1.29767 WP_003087865.1.29848 WP_003087865.1.29920 WP_003087865.1.29973 WP_003087865.1.30020 WP_003087865.1.30081 WP_003087865.1.30254 WP_003087865.1.3030 WP_003087865.1.30365 WP_003087865.1.30474 WP_003087865.1.30475 WP_003087865.1.30563 WP_003087865.1.30567 WP_003087865.1.30614 WP_003087865.1.30615 WP_003087865.1.30625 WP_003087865.1.30693 WP_003087865.1.30707 WP_003087865.1.3072 WP_003087865.1.30740 WP_003087865.1.30797 WP_003087865.1.30815 WP_003087865.1.30842 WP_003087865.1.30886 WP_003087865.1.30943 WP_003087865.1.30994 WP_003087865.1.31076 WP_003087865.1.31087 WP_003087865.1.31105 WP_003087865.1.31138 WP_003087865.1.31147 WP_003087865.1.31279 WP_003087865.1.31361 WP_003087865.1.31457 WP_003087865.1.31563 WP_003087865.1.31633 WP_003087865.1.31655 WP_003087865.1.3172 WP_003087865.1.31732 WP_003087865.1.31751 WP_003087865.1.31848 WP_003087865.1.319 WP_003087865.1.32134 WP_003087865.1.32137 WP_003087865.1.32235 WP_003087865.1.32289 WP_003087865.1.32314 WP_003087865.1.32359 WP_003087865.1.32447 WP_003087865.1.32523 WP_003087865.1.32544 WP_003087865.1.32596 WP_003087865.1.32626 WP_003087865.1.32637 WP_003087865.1.32821 WP_003087865.1.32869 WP_003087865.1.32879 WP_003087865.1.33009 WP_003087865.1.33047 WP_003087865.1.33097 WP_003087865.1.33133 WP_003087865.1.33152 WP_003087865.1.33186 WP_003087865.1.33204 WP_003087865.1.33210 WP_003087865.1.33216 WP_003087865.1.33294 WP_003087865.1.33340 WP_003087865.1.33387 WP_003087865.1.33438 WP_003087865.1.33455 WP_003087865.1.3351 WP_003087865.1.33517 WP_003087865.1.33521 WP_003087865.1.33523 WP_003087865.1.33547 WP_003087865.1.33549 WP_003087865.1.33653 WP_003087865.1.33658 WP_003087865.1.3368 WP_003087865.1.33728 WP_003087865.1.33733 WP_003087865.1.3376 WP_003087865.1.33801 WP_003087865.1.33814 WP_003087865.1.33824 WP_003087865.1.33833 WP_003087865.1.3385 WP_003087865.1.33945 WP_003087865.1.34000 WP_003087865.1.34039 WP_003087865.1.34150 WP_003087865.1.34151 WP_003087865.1.34180 WP_003087865.1.34191 WP_003087865.1.34203 WP_003087865.1.34317 WP_003087865.1.34324 WP_003087865.1.3436 WP_003087865.1.34402 WP_003087865.1.3452 WP_003087865.1.34556 WP_003087865.1.34568 WP_003087865.1.34583 WP_003087865.1.34670 WP_003087865.1.34689 WP_003087865.1.34832 WP_003087865.1.34876 WP_003087865.1.34878 WP_003087865.1.34901 WP_003087865.1.34922 WP_003087865.1.34942 WP_003087865.1.35104 WP_003087865.1.35149 WP_003087865.1.35231 WP_003087865.1.3531 WP_003087865.1.35353 WP_003087865.1.3540 WP_003087865.1.35431 WP_003087865.1.35442 WP_003087865.1.35480 WP_003087865.1.35512 WP_003087865.1.35529 WP_003087865.1.3555 WP_003087865.1.35573 WP_003087865.1.35599 WP_003087865.1.35641 WP_003087865.1.35669 WP_003087865.1.35679 WP_003087865.1.3568 WP_003087865.1.35682 WP_003087865.1.3576 WP_003087865.1.35762 WP_003087865.1.35768 WP_003087865.1.35822 WP_003087865.1.35843 WP_003087865.1.35857 WP_003087865.1.35872 WP_003087865.1.35968 WP_003087865.1.35984 WP_003087865.1.36064 WP_003087865.1.36121 WP_003087865.1.36170 WP_003087865.1.36267 WP_003087865.1.36285 WP_003087865.1.36378 WP_003087865.1.36435 WP_003087865.1.36487 WP_003087865.1.36521 WP_003087865.1.3653 WP_003087865.1.36587 WP_003087865.1.36608 WP_003087865.1.3662 WP_003087865.1.36630 WP_003087865.1.36665 WP_003087865.1.36708 WP_003087865.1.36756 WP_003087865.1.37050 WP_003087865.1.37097 WP_003087865.1.37163 WP_003087865.1.37208 WP_003087865.1.3721 WP_003087865.1.37216 WP_003087865.1.373 WP_003087865.1.37366 WP_003087865.1.37416 WP_003087865.1.3742 WP_003087865.1.37571 WP_003087865.1.3768 WP_003087865.1.37698 WP_003087865.1.37703 WP_003087865.1.3773 WP_003087865.1.3781 WP_003087865.1.37814 WP_003087865.1.37818 WP_003087865.1.37826 WP_003087865.1.37842 WP_003087865.1.3785 WP_003087865.1.3792 WP_003087865.1.38023 WP_003087865.1.38060 WP_003087865.1.38087 WP_003087865.1.38146 WP_003087865.1.38151 WP_003087865.1.3818 WP_003087865.1.38186 WP_003087865.1.3833 WP_003087865.1.38335 WP_003087865.1.38337 WP_003087865.1.38406 WP_003087865.1.38430 WP_003087865.1.38502 WP_003087865.1.38505 WP_003087865.1.38510 WP_003087865.1.38582 WP_003087865.1.38583 WP_003087865.1.38657 WP_003087865.1.38661 WP_003087865.1.3870 WP_003087865.1.38706 WP_003087865.1.38727 WP_003087865.1.38816 WP_003087865.1.38834 WP_003087865.1.38889 WP_003087865.1.38932 WP_003087865.1.38971 WP_003087865.1.39046 WP_003087865.1.39088 WP_003087865.1.39122 WP_003087865.1.39186 WP_003087865.1.39271 WP_003087865.1.39326 WP_003087865.1.39345 WP_003087865.1.39444 WP_003087865.1.39458 WP_003087865.1.39704 WP_003087865.1.39765 WP_003087865.1.39786 WP_003087865.1.39811 WP_003087865.1.39920 WP_003087865.1.39949 WP_003087865.1.40059 WP_003087865.1.40115 WP_003087865.1.40213 WP_003087865.1.40237 WP_003087865.1.40243 WP_003087865.1.40271 WP_003087865.1.40442 WP_003087865.1.40512 WP_003087865.1.40513 WP_003087865.1.40546 WP_003087865.1.4058 WP_003087865.1.40595 WP_003087865.1.40703 WP_003087865.1.40874 WP_003087865.1.40950 WP_003087865.1.40984 WP_003087865.1.40993 WP_003087865.1.40994 WP_003087865.1.41110 WP_003087865.1.41137 WP_003087865.1.41199 WP_003087865.1.41290 WP_003087865.1.41301 WP_003087865.1.41384 WP_003087865.1.41412 WP_003087865.1.41429 WP_003087865.1.41492 WP_003087865.1.41502 WP_003087865.1.41624 WP_003087865.1.41692 WP_003087865.1.41703 WP_003087865.1.41732 WP_003087865.1.41748 WP_003087865.1.41773 WP_003087865.1.41832 WP_003087865.1.41888 WP_003087865.1.4190 WP_003087865.1.41939 WP_003087865.1.42041 WP_003087865.1.42047 WP_003087865.1.42146 WP_003087865.1.42259 WP_003087865.1.42294 WP_003087865.1.42316 WP_003087865.1.42381 WP_003087865.1.42388 WP_003087865.1.42463 WP_003087865.1.42499 WP_003087865.1.42508 WP_003087865.1.42634 WP_003087865.1.42690 WP_003087865.1.42696 WP_003087865.1.42723 WP_003087865.1.4273 WP_003087865.1.42757 WP_003087865.1.42778 WP_003087865.1.42854 WP_003087865.1.42856 WP_003087865.1.42870 WP_003087865.1.42917 WP_003087865.1.42946 WP_003087865.1.42952 WP_003087865.1.42972 WP_003087865.1.42973 WP_003087865.1.43022 WP_003087865.1.43024 WP_003087865.1.43026 WP_003087865.1.43049 WP_003087865.1.43106 WP_003087865.1.43107 WP_003087865.1.43212 WP_003087865.1.43245 WP_003087865.1.43286 WP_003087865.1.43293 WP_003087865.1.43326 WP_003087865.1.43330 WP_003087865.1.43356 WP_003087865.1.4348 WP_003087865.1.43593 WP_003087865.1.43662 WP_003087865.1.43696 WP_003087865.1.43756 WP_003087865.1.43783 WP_003087865.1.4381 WP_003087865.1.43811 WP_003087865.1.43826 WP_003087865.1.4397 WP_003087865.1.4398 WP_003087865.1.43998 WP_003087865.1.44094 WP_003087865.1.44213 WP_003087865.1.44260 WP_003087865.1.44269 WP_003087865.1.44373 WP_003087865.1.44486 WP_003087865.1.445 WP_003087865.1.44552 WP_003087865.1.44563 WP_003087865.1.44581 WP_003087865.1.44725 WP_003087865.1.44739 WP_003087865.1.44760 WP_003087865.1.44804 WP_003087865.1.44870 WP_003087865.1.45090 WP_003087865.1.45146 WP_003087865.1.45202 WP_003087865.1.4522 WP_003087865.1.45228 WP_003087865.1.45298 WP_003087865.1.45306 WP_003087865.1.45312 WP_003087865.1.4532 WP_003087865.1.45328 WP_003087865.1.45353 WP_003087865.1.45358 WP_003087865.1.45464 WP_003087865.1.45478 WP_003087865.1.45485 WP_003087865.1.45604 WP_003087865.1.45611 WP_003087865.1.45636 WP_003087865.1.45711 WP_003087865.1.45723 WP_003087865.1.45934 WP_003087865.1.45946 WP_003087865.1.45961 WP_003087865.1.46010 WP_003087865.1.46032 WP_003087865.1.46093 WP_003087865.1.461 WP_003087865.1.46152 WP_003087865.1.46200 WP_003087865.1.46306 WP_003087865.1.4640 WP_003087865.1.46502 WP_003087865.1.46633 WP_003087865.1.46755 WP_003087865.1.46787 WP_003087865.1.46826 WP_003087865.1.46846 WP_003087865.1.46866 WP_003087865.1.46885 WP_003087865.1.46926 WP_003087865.1.46935 WP_003087865.1.4699 WP_003087865.1.47101 WP_003087865.1.47150 WP_003087865.1.47155 WP_003087865.1.47251 WP_003087865.1.4726 WP_003087865.1.47296 WP_003087865.1.47312 WP_003087865.1.47314 WP_003087865.1.47469 WP_003087865.1.47480 WP_003087865.1.47527 WP_003087865.1.47551 WP_003087865.1.47598 WP_003087865.1.47645 WP_003087865.1.47774 WP_003087865.1.47930 WP_003087865.1.47970 WP_003087865.1.48001 WP_003087865.1.48024 WP_003087865.1.48086 WP_003087865.1.48094 WP_003087865.1.48141 WP_003087865.1.48172 WP_003087865.1.48178 WP_003087865.1.48321 WP_003087865.1.48334 WP_003087865.1.4836 WP_003087865.1.48378 WP_003087865.1.48382 WP_003087865.1.48413 WP_003087865.1.48472 WP_003087865.1.48474 WP_003087865.1.48487 WP_003087865.1.48576 WP_003087865.1.48579 WP_003087865.1.48747 WP_003087865.1.48810 WP_003087865.1.48820 WP_003087865.1.48840 WP_003087865.1.48842 WP_003087865.1.48851 WP_003087865.1.48870 WP_003087865.1.48961 WP_003087865.1.49108 WP_003087865.1.49265 WP_003087865.1.49266 WP_003087865.1.49277 WP_003087865.1.49293 WP_003087865.1.49360 WP_003087865.1.49416 WP_003087865.1.49557 WP_003087865.1.49566 WP_003087865.1.49688 WP_003087865.1.49798 WP_003087865.1.49806 WP_003087865.1.49833 WP_003087865.1.49842 WP_003087865.1.49922 WP_003087865.1.49948 WP_003087865.1.49988 WP_003087865.1.49998 WP_003087865.1.50176 WP_003087865.1.50180 WP_003087865.1.50232 WP_003087865.1.50242 WP_003087865.1.5043 WP_003087865.1.50450 WP_003087865.1.50459 WP_003087865.1.50567 WP_003087865.1.50653 WP_003087865.1.50691 WP_003087865.1.50734 WP_003087865.1.50783 WP_003087865.1.50814 WP_003087865.1.50967 WP_003087865.1.51019 WP_003087865.1.51035 WP_003087865.1.51136 WP_003087865.1.51173 WP_003087865.1.51183 WP_003087865.1.51267 WP_003087865.1.51273 WP_003087865.1.5132 WP_003087865.1.51472 WP_003087865.1.51501 WP_003087865.1.51538 WP_003087865.1.51549 WP_003087865.1.51585 WP_003087865.1.51682 WP_003087865.1.51727 WP_003087865.1.51733 WP_003087865.1.51807 WP_003087865.1.51889 WP_003087865.1.51917 WP_003087865.1.51937 WP_003087865.1.51943 WP_003087865.1.51957 WP_003087865.1.51976 WP_003087865.1.52043 WP_003087865.1.52146 WP_003087865.1.52152 WP_003087865.1.52212 WP_003087865.1.52220 WP_003087865.1.5226 WP_003087865.1.52334 WP_003087865.1.52355 WP_003087865.1.52372 WP_003087865.1.52403 WP_003087865.1.52500 WP_003087865.1.52537 WP_003087865.1.5258 WP_003087865.1.52583 WP_003087865.1.52591 WP_003087865.1.5260 WP_003087865.1.52690 WP_003087865.1.52700 WP_003087865.1.52784 WP_003087865.1.52790 WP_003087865.1.52810 WP_003087865.1.52850 WP_003087865.1.5289 WP_003087865.1.52939 WP_003087865.1.53038 WP_003087865.1.53070 WP_003087865.1.53287 WP_003087865.1.53414 WP_003087865.1.53486 WP_003087865.1.53528 WP_003087865.1.53530 WP_003087865.1.53586 WP_003087865.1.53663 WP_003087865.1.53678 WP_003087865.1.53726 WP_003087865.1.53826 WP_003087865.1.53932 WP_003087865.1.53946 WP_003087865.1.53948 WP_003087865.1.53951 WP_003087865.1.54003 WP_003087865.1.54076 WP_003087865.1.54078 WP_003087865.1.54090 WP_003087865.1.54133 WP_003087865.1.54146 WP_003087865.1.54248 WP_003087865.1.5427 WP_003087865.1.54293 WP_003087865.1.54497 WP_003087865.1.54571 WP_003087865.1.54809 WP_003087865.1.54974 WP_003087865.1.55 WP_003087865.1.55089 WP_003087865.1.55169 WP_003087865.1.55318 WP_003087865.1.55347 WP_003087865.1.55387 WP_003087865.1.55400 WP_003087865.1.55445 WP_003087865.1.55478 WP_003087865.1.55543 WP_003087865.1.55729 WP_003087865.1.55813 WP_003087865.1.56013 WP_003087865.1.56145 WP_003087865.1.56171 WP_003087865.1.56187 WP_003087865.1.56188 WP_003087865.1.56196 WP_003087865.1.56228 WP_003087865.1.56229 WP_003087865.1.56315 WP_003087865.1.56442 WP_003087865.1.56452 WP_003087865.1.56465 WP_003087865.1.56474 WP_003087865.1.56626 WP_003087865.1.56632 WP_003087865.1.56745 WP_003087865.1.56797 WP_003087865.1.56808 WP_003087865.1.56819 WP_003087865.1.56896 WP_003087865.1.56973 WP_003087865.1.57020 WP_003087865.1.57065 WP_003087865.1.57113 WP_003087865.1.57131 WP_003087865.1.57140 WP_003087865.1.57276 WP_003087865.1.5731 WP_003087865.1.57339 WP_003087865.1.57369 WP_003087865.1.57417 WP_003087865.1.57460 WP_003087865.1.57477 WP_003087865.1.57548 WP_003087865.1.57792 WP_003087865.1.57839 WP_003087865.1.57841 WP_003087865.1.57921 WP_003087865.1.57966 WP_003087865.1.58019 WP_003087865.1.58056 WP_003087865.1.58155 WP_003087865.1.58162 WP_003087865.1.58183 WP_003087865.1.58193 WP_003087865.1.58200 WP_003087865.1.58294 WP_003087865.1.58360 WP_003087865.1.58417 WP_003087865.1.58436 WP_003087865.1.58482 WP_003087865.1.5850 WP_003087865.1.58510 WP_003087865.1.5856 WP_003087865.1.58581 WP_003087865.1.5869 WP_003087865.1.58785 WP_003087865.1.58800 WP_003087865.1.58838 WP_003087865.1.58845 WP_003087865.1.58944 WP_003087865.1.58952 WP_003087865.1.5897 WP_003087865.1.59013 WP_003087865.1.59076 WP_003087865.1.59158 WP_003087865.1.59176 WP_003087865.1.59212 WP_003087865.1.59249 WP_003087865.1.59250 WP_003087865.1.59339 WP_003087865.1.5937 WP_003087865.1.59385 WP_003087865.1.594 WP_003087865.1.59469 WP_003087865.1.59688 WP_003087865.1.59724 WP_003087865.1.59759 WP_003087865.1.59797 WP_003087865.1.59831 WP_003087865.1.59943 WP_003087865.1.60051 WP_003087865.1.60062 WP_003087865.1.60079 WP_003087865.1.60082 WP_003087865.1.60084 WP_003087865.1.60396 WP_003087865.1.60415 WP_003087865.1.60472 WP_003087865.1.60600 WP_003087865.1.60602 WP_003087865.1.60603 WP_003087865.1.60686 WP_003087865.1.607 WP_003087865.1.60850 WP_003087865.1.60910 WP_003087865.1.60916 WP_003087865.1.60970 WP_003087865.1.61122 WP_003087865.1.61130 WP_003087865.1.61191 WP_003087865.1.61209 WP_003087865.1.61222 WP_003087865.1.61269 WP_003087865.1.61294 WP_003087865.1.61299 WP_003087865.1.6130 WP_003087865.1.61366 WP_003087865.1.61431 WP_003087865.1.61493 WP_003087865.1.61549 WP_003087865.1.61589 WP_003087865.1.61598 WP_003087865.1.616 WP_003087865.1.61696 WP_003087865.1.6173 WP_003087865.1.62010 WP_003087865.1.62180 WP_003087865.1.62186 WP_003087865.1.62357 WP_003087865.1.62396 WP_003087865.1.62483 WP_003087865.1.62516 WP_003087865.1.62534 WP_003087865.1.626 WP_003087865.1.62604 WP_003087865.1.62688 WP_003087865.1.62701 WP_003087865.1.62703 WP_003087865.1.62708 WP_003087865.1.62768 WP_003087865.1.62772 WP_003087865.1.6280 WP_003087865.1.6283 WP_003087865.1.62834 WP_003087865.1.62838 WP_003087865.1.62873 WP_003087865.1.62917 WP_003087865.1.62961 WP_003087865.1.62977 WP_003087865.1.63041 WP_003087865.1.63057 WP_003087865.1.63193 WP_003087865.1.63196 WP_003087865.1.63338 WP_003087865.1.63369 WP_003087865.1.63401 WP_003087865.1.63591 WP_003087865.1.63597 WP_003087865.1.63634 WP_003087865.1.63659 WP_003087865.1.63739 WP_003087865.1.63784 WP_003087865.1.63929 WP_003087865.1.63941 WP_003087865.1.63995 WP_003087865.1.64155 WP_003087865.1.64329 WP_003087865.1.64433 WP_003087865.1.6450 WP_003087865.1.64544 WP_003087865.1.64603 WP_003087865.1.64605 WP_003087865.1.6461 WP_003087865.1.64611 WP_003087865.1.64807 WP_003087865.1.64854 WP_003087865.1.64862 WP_003087865.1.64880 WP_003087865.1.64886 WP_003087865.1.64983 WP_003087865.1.64984 WP_003087865.1.65009 WP_003087865.1.65066 WP_003087865.1.65092 WP_003087865.1.65095 WP_003087865.1.65099 WP_003087865.1.65145 WP_003087865.1.65196 WP_003087865.1.65197 WP_003087865.1.65237 WP_003087865.1.65247 WP_003087865.1.65304 WP_003087865.1.65312 WP_003087865.1.65316 WP_003087865.1.65335 WP_003087865.1.65337 WP_003087865.1.65457 WP_003087865.1.65478 WP_003087865.1.65549 WP_003087865.1.65588 WP_003087865.1.65632 WP_003087865.1.65642 WP_003087865.1.65679 WP_003087865.1.65779 WP_003087865.1.65819 WP_003087865.1.65867 WP_003087865.1.65926 WP_003087865.1.66062 WP_003087865.1.66088 WP_003087865.1.66155 WP_003087865.1.66165 WP_003087865.1.6627 WP_003087865.1.66277 WP_003087865.1.6629 WP_003087865.1.66345 WP_003087865.1.66348 WP_003087865.1.66371 WP_003087865.1.66526 WP_003087865.1.66563 WP_003087865.1.66693 WP_003087865.1.66721 WP_003087865.1.66929 WP_003087865.1.66950 WP_003087865.1.66982 WP_003087865.1.67010 WP_003087865.1.67124 WP_003087865.1.67188 WP_003087865.1.67192 WP_003087865.1.67205 WP_003087865.1.67261 WP_003087865.1.67269 WP_003087865.1.6734 WP_003087865.1.67370 WP_003087865.1.67388 WP_003087865.1.67472 WP_003087865.1.67506 WP_003087865.1.67526 WP_003087865.1.67531 WP_003087865.1.67545 WP_003087865.1.67686 WP_003087865.1.67755 WP_003087865.1.67830 WP_003087865.1.67874 WP_003087865.1.67875 WP_003087865.1.67903 WP_003087865.1.67937 WP_003087865.1.6796 WP_003087865.1.68000 WP_003087865.1.6808 WP_003087865.1.68158 WP_003087865.1.68162 WP_003087865.1.68172 WP_003087865.1.68194 WP_003087865.1.68252 WP_003087865.1.68317 WP_003087865.1.68446 WP_003087865.1.68448 WP_003087865.1.68499 WP_003087865.1.6850 WP_003087865.1.68541 WP_003087865.1.68561 WP_003087865.1.68638 WP_003087865.1.68756 WP_003087865.1.68790 WP_003087865.1.68850 WP_003087865.1.68857 WP_003087865.1.68862 WP_003087865.1.68881 WP_003087865.1.68938 WP_003087865.1.68979 WP_003087865.1.69088 WP_003087865.1.6911 WP_003087865.1.69159 WP_003087865.1.69260 WP_003087865.1.6931 WP_003087865.1.69330 WP_003087865.1.6937 WP_003087865.1.69411 WP_003087865.1.69556 WP_003087865.1.69702 WP_003087865.1.69791 WP_003087865.1.69907 WP_003087865.1.69993 WP_003087865.1.70092 WP_003087865.1.70098 WP_003087865.1.70194 WP_003087865.1.70229 WP_003087865.1.70331 WP_003087865.1.70460 WP_003087865.1.70470 WP_003087865.1.70537 WP_003087865.1.70648 WP_003087865.1.70650 WP_003087865.1.70670 WP_003087865.1.7077 WP_003087865.1.70778 WP_003087865.1.70831 WP_003087865.1.71038 WP_003087865.1.71141 WP_003087865.1.71249 WP_003087865.1.71254 WP_003087865.1.7128 WP_003087865.1.71290 WP_003087865.1.71412 WP_003087865.1.71610 WP_003087865.1.7163 WP_003087865.1.71642 WP_003087865.1.71666 WP_003087865.1.71738 WP_003087865.1.71799 WP_003087865.1.71862 WP_003087865.1.71934 WP_003087865.1.72149 WP_003087865.1.72167 WP_003087865.1.72181 WP_003087865.1.72183 WP_003087865.1.7219 WP_003087865.1.72287 WP_003087865.1.72331 WP_003087865.1.72346 WP_003087865.1.72378 WP_003087865.1.72447 WP_003087865.1.72458 WP_003087865.1.72541 WP_003087865.1.72562 WP_003087865.1.72570 WP_003087865.1.72662 WP_003087865.1.72669 WP_003087865.1.7276 WP_003087865.1.72768 WP_003087865.1.72772 WP_003087865.1.72782 WP_003087865.1.72845 WP_003087865.1.72920 WP_003087865.1.73035 WP_003087865.1.73048 WP_003087865.1.7308 WP_003087865.1.73149 WP_003087865.1.73172 WP_003087865.1.73192 WP_003087865.1.7327 WP_003087865.1.7329 WP_003087865.1.733 WP_003087865.1.73455 WP_003087865.1.73490 WP_003087865.1.73523 WP_003087865.1.73541 WP_003087865.1.73601 WP_003087865.1.73719 WP_003087865.1.73728 WP_003087865.1.7377 WP_003087865.1.7382 WP_003087865.1.73860 WP_003087865.1.73889 WP_003087865.1.73911 WP_003087865.1.74 WP_003087865.1.74072 WP_003087865.1.74074 WP_003087865.1.7408 WP_003087865.1.74182 WP_003087865.1.74219 WP_003087865.1.74264 WP_003087865.1.74268 WP_003087865.1.74281 WP_003087865.1.74287 WP_003087865.1.74326 WP_003087865.1.7445 WP_003087865.1.74458 WP_003087865.1.74473 WP_003087865.1.7448 WP_003087865.1.7456 WP_003087865.1.74568 WP_003087865.1.74604 WP_003087865.1.74637 WP_003087865.1.74685 WP_003087865.1.74772 WP_003087865.1.748 WP_003087865.1.74878 WP_003087865.1.74941 WP_003087865.1.74958 WP_003087865.1.7501 WP_003087865.1.75119 WP_003087865.1.75204 WP_003087865.1.75277 WP_003087865.1.75389 WP_003087865.1.75431 WP_003087865.1.7547 WP_003087865.1.75549 WP_003087865.1.75573 WP_003087865.1.75580 WP_003087865.1.75599 WP_003087865.1.75603 WP_003087865.1.75631 WP_003087865.1.7568 WP_003087865.1.75756 WP_003087865.1.75792 WP_003087865.1.75826 WP_003087865.1.75860 WP_003087865.1.75935 WP_003087865.1.75947 WP_003087865.1.7595 WP_003087865.1.76141 WP_003087865.1.76145 WP_003087865.1.76322 WP_003087865.1.76355 WP_003087865.1.76383 WP_003087865.1.76399 WP_003087865.1.76441 WP_003087865.1.76467 WP_003087865.1.76484 WP_003087865.1.76543 WP_003087865.1.76600 WP_003087865.1.76633 WP_003087865.1.7666 WP_003087865.1.76716 WP_003087865.1.76775 WP_003087865.1.76791 WP_003087865.1.76861 WP_003087865.1.76922 WP_003087865.1.77235 WP_003087865.1.77238 WP_003087865.1.77286 WP_003087865.1.77317 WP_003087865.1.77442 WP_003087865.1.77490 WP_003087865.1.77566 WP_003087865.1.77587 WP_003087865.1.77686 WP_003087865.1.77769 WP_003087865.1.77819 WP_003087865.1.77834 WP_003087865.1.78104 WP_003087865.1.78118 WP_003087865.1.78134 WP_003087865.1.78148 WP_003087865.1.78158 WP_003087865.1.78280 WP_003087865.1.78380 WP_003087865.1.7840 WP_003087865.1.78409 WP_003087865.1.78430 WP_003087865.1.78570 WP_003087865.1.78599 WP_003087865.1.78669 WP_003087865.1.78795 WP_003087865.1.788 WP_003087865.1.78926 WP_003087865.1.78947 WP_003087865.1.78986 WP_003087865.1.79003 WP_003087865.1.79007 WP_003087865.1.79053 WP_003087865.1.79060 WP_003087865.1.79177 WP_003087865.1.79193 WP_003087865.1.79256 WP_003087865.1.79279 WP_003087865.1.79286 WP_003087865.1.79311 WP_003087865.1.79357 WP_003087865.1.79364 WP_003087865.1.79421 WP_003087865.1.79429 WP_003087865.1.7945 WP_003087865.1.79507 WP_003087865.1.7953 WP_003087865.1.79544 WP_003087865.1.79569 WP_003087865.1.79754 WP_003087865.1.79788 WP_003087865.1.79883 WP_003087865.1.799 WP_003087865.1.79902 WP_003087865.1.79908 WP_003087865.1.8 WP_003087865.1.80087 WP_003087865.1.80102 WP_003087865.1.8013 WP_003087865.1.80174 WP_003087865.1.80258 WP_003087865.1.8028 WP_003087865.1.80306 WP_003087865.1.8038 WP_003087865.1.80410 WP_003087865.1.80411 WP_003087865.1.80454 WP_003087865.1.80481 WP_003087865.1.8051 WP_003087865.1.8064 WP_003087865.1.80644 WP_003087865.1.80645 WP_003087865.1.80683 WP_003087865.1.80715 WP_003087865.1.80720 WP_003087865.1.80785 WP_003087865.1.80880 WP_003087865.1.80892 WP_003087865.1.80926 WP_003087865.1.80929 WP_003087865.1.80969 WP_003087865.1.81081 WP_003087865.1.81082 WP_003087865.1.81206 WP_003087865.1.81331 WP_003087865.1.81338 WP_003087865.1.81349 WP_003087865.1.81368 WP_003087865.1.81380 WP_003087865.1.8141 WP_003087865.1.81426 WP_003087865.1.81470 WP_003087865.1.81487 WP_003087865.1.81622 WP_003087865.1.81728 WP_003087865.1.81742 WP_003087865.1.81748 WP_003087865.1.81771 WP_003087865.1.81784 WP_003087865.1.81816 WP_003087865.1.81834 WP_003087865.1.81844 WP_003087865.1.81856 WP_003087865.1.81927 WP_003087865.1.81950 WP_003087865.1.81957 WP_003087865.1.81960 WP_003087865.1.81986 WP_003087865.1.82178 WP_003087865.1.82260 WP_003087865.1.8227 WP_003087865.1.82310 WP_003087865.1.82312 WP_003087865.1.82328 WP_003087865.1.82442 WP_003087865.1.82487 WP_003087865.1.82580 WP_003087865.1.82604 WP_003087865.1.82606 WP_003087865.1.82620 WP_003087865.1.82643 WP_003087865.1.82686 WP_003087865.1.82798 WP_003087865.1.82810 WP_003087865.1.82864 WP_003087865.1.82887 WP_003087865.1.82936 WP_003087865.1.83025 WP_003087865.1.83131 WP_003087865.1.83184 WP_003087865.1.83213 WP_003087865.1.83251 WP_003087865.1.83267 WP_003087865.1.83296 WP_003087865.1.83317 WP_003087865.1.83394 WP_003087865.1.83440 WP_003087865.1.83463 WP_003087865.1.83503 WP_003087865.1.8351 WP_003087865.1.8353 WP_003087865.1.83534 WP_003087865.1.83540 WP_003087865.1.8357 WP_003087865.1.83637 WP_003087865.1.83698 WP_003087865.1.83871 WP_003087865.1.83937 WP_003087865.1.83946 WP_003087865.1.84003 WP_003087865.1.84008 WP_003087865.1.84138 WP_003087865.1.84162 WP_003087865.1.84177 WP_003087865.1.84190 WP_003087865.1.84271 WP_003087865.1.84297 WP_003087865.1.8437 WP_003087865.1.84374 WP_003087865.1.84404 WP_003087865.1.84471 WP_003087865.1.8453 WP_003087865.1.84558 WP_003087865.1.84674 WP_003087865.1.84684 WP_003087865.1.84702 WP_003087865.1.84715 WP_003087865.1.84754 WP_003087865.1.84792 WP_003087865.1.84825 WP_003087865.1.8484 WP_003087865.1.84865 WP_003087865.1.84937 WP_003087865.1.85059 WP_003087865.1.85150 WP_003087865.1.85220 WP_003087865.1.85290 WP_003087865.1.85298 WP_003087865.1.85311 WP_003087865.1.85318 WP_003087865.1.85357 WP_003087865.1.85446 WP_003087865.1.85453 WP_003087865.1.85633 WP_003087865.1.85638 WP_003087865.1.85788 WP_003087865.1.85897 WP_003087865.1.85910 WP_003087865.1.85920 WP_003087865.1.85978 WP_003087865.1.86047 WP_003087865.1.86055 WP_003087865.1.86058 WP_003087865.1.861 WP_003087865.1.86125 WP_003087865.1.86182 WP_003087865.1.86243 WP_003087865.1.86278 WP_003087865.1.86287 WP_003087865.1.86293 WP_003087865.1.86432 WP_003087865.1.8645 WP_003087865.1.865 WP_003087865.1.86506 WP_003087865.1.86545 WP_003087865.1.86552 WP_003087865.1.86554 WP_003087865.1.86595 WP_003087865.1.86652 WP_003087865.1.86665 WP_003087865.1.867 WP_003087865.1.86774 WP_003087865.1.86785 WP_003087865.1.86796 WP_003087865.1.86813 WP_003087865.1.86822 WP_003087865.1.86970 WP_003087865.1.86985 WP_003087865.1.87104 WP_003087865.1.8718 WP_003087865.1.87182 WP_003087865.1.87183 WP_003087865.1.8727 WP_003087865.1.87316 WP_003087865.1.87390 WP_003087865.1.87435 WP_003087865.1.87463 WP_003087865.1.8749 WP_003087865.1.87530 WP_003087865.1.87648 WP_003087865.1.87763 WP_003087865.1.8777 WP_003087865.1.8785 WP_003087865.1.87877 WP_003087865.1.87888 WP_003087865.1.87970 WP_003087865.1.87975 WP_003087865.1.87981 WP_003087865.1.88004 WP_003087865.1.88308 WP_003087865.1.88360 WP_003087865.1.88388 WP_003087865.1.88517 WP_003087865.1.8852 WP_003087865.1.88540 WP_003087865.1.88550 WP_003087865.1.88714 WP_003087865.1.88750 WP_003087865.1.88796 WP_003087865.1.889 WP_003087865.1.88969 WP_003087865.1.89083 WP_003087865.1.89098 WP_003087865.1.89245 WP_003087865.1.89276 WP_003087865.1.89330 WP_003087865.1.89409 WP_003087865.1.89434 WP_003087865.1.89480 WP_003087865.1.89577 WP_003087865.1.89610 WP_003087865.1.89638 WP_003087865.1.89662 WP_003087865.1.89669 WP_003087865.1.89736 WP_003087865.1.8976 WP_003087865.1.89776 WP_003087865.1.89805 WP_003087865.1.89866 WP_003087865.1.89868 WP_003087865.1.89871 WP_003087865.1.89886 WP_003087865.1.89992 WP_003087865.1.90032 WP_003087865.1.90056 WP_003087865.1.90110 WP_003087865.1.90141 WP_003087865.1.90150 WP_003087865.1.90225 WP_003087865.1.90242 WP_003087865.1.90268 WP_003087865.1.90272 WP_003087865.1.90306 WP_003087865.1.90412 WP_003087865.1.9056 WP_003087865.1.90569 WP_003087865.1.90655 WP_003087865.1.90770 WP_003087865.1.90999 WP_003087865.1.91012 WP_003087865.1.91093 WP_003087865.1.91161 WP_003087865.1.9120 WP_003087865.1.91204 WP_003087865.1.91236 WP_003087865.1.91281 WP_003087865.1.91336 WP_003087865.1.91392 WP_003087865.1.91416 WP_003087865.1.9143 WP_003087865.1.91431 WP_003087865.1.91438 WP_003087865.1.91467 WP_003087865.1.91527 WP_003087865.1.91796 WP_003087865.1.91803 WP_003087865.1.9182 WP_003087865.1.91838 WP_003087865.1.91846 WP_003087865.1.91860 WP_003087865.1.91882 WP_003087865.1.9191 WP_003087865.1.92175 WP_003087865.1.9219 WP_003087865.1.92314 WP_003087865.1.92454 WP_003087865.1.92573 WP_003087865.1.92594 WP_003087865.1.92630 WP_003087865.1.92642 WP_003087865.1.9272 WP_003087865.1.92759 WP_003087865.1.92769 WP_003087865.1.92839 WP_003087865.1.92847 WP_003087865.1.92924 WP_003087865.1.92930 WP_003087865.1.93001 WP_003087865.1.93090 WP_003087865.1.93122 WP_003087865.1.93144 WP_003087865.1.93148 WP_003087865.1.93196 WP_003087865.1.9349 WP_003087865.1.93493 WP_003087865.1.93498 WP_003087865.1.93520 WP_003087865.1.93547 WP_003087865.1.93562 WP_003087865.1.93568 WP_003087865.1.93797 WP_003087865.1.93889 WP_003087865.1.94004 WP_003087865.1.94031 WP_003087865.1.94065 WP_003087865.1.94078 WP_003087865.1.94136 WP_003087865.1.94174 WP_003087865.1.94211 WP_003087865.1.94218 WP_003087865.1.94230 WP_003087865.1.94243 WP_003087865.1.94288 WP_003087865.1.94333 WP_003087865.1.94349 WP_003087865.1.94434 WP_003087865.1.9444 WP_003087865.1.94682 WP_003087865.1.94732 WP_003087865.1.94742 WP_003087865.1.94814 WP_003087865.1.94874 WP_003087865.1.94881 WP_003087865.1.94897 WP_003087865.1.94943 WP_003087865.1.95018 WP_003087865.1.95025 WP_003087865.1.95027 WP_003087865.1.95056 WP_003087865.1.95117 WP_003087865.1.95132 WP_003087865.1.95187 WP_003087865.1.95207 WP_003087865.1.95217 WP_003087865.1.95359 WP_003087865.1.95488 WP_003087865.1.95525 WP_003087865.1.95536 WP_003087865.1.95638 WP_003087865.1.95668 WP_003087865.1.95745 WP_003087865.1.95751 WP_003087865.1.95782 WP_003087865.1.95787 WP_003087865.1.95820 WP_003087865.1.95825 WP_003087865.1.95959 WP_003087865.1.9599 WP_003087865.1.95994 WP_003087865.1.95999 WP_003087865.1.9604 WP_003087865.1.96058 WP_003087865.1.961 WP_003087865.1.96134 WP_003087865.1.96193 WP_003087865.1.96243 WP_003087865.1.96267 WP_003087865.1.96384 WP_003087865.1.96434 WP_003087865.1.96452 WP_003087865.1.96506 WP_003087865.1.96702 WP_003087865.1.96714 WP_003087865.1.96863 WP_003087865.1.96967 WP_003087865.1.97118 WP_003087865.1.97204 WP_003087865.1.97213 WP_003087865.1.9722 WP_003087865.1.97271 WP_003087865.1.97272 WP_003087865.1.97461 WP_003087865.1.97474 WP_003087865.1.97499 WP_003087865.1.97503 WP_003087865.1.97614 WP_003087865.1.977 WP_003087865.1.97826 WP_003087865.1.98111 WP_003087865.1.98260 WP_003087865.1.98276 WP_003087865.1.98410 WP_003087865.1.98414 WP_003087865.1.98433 WP_003087865.1.9845 WP_003087865.1.985 WP_003087865.1.98515 WP_003087865.1.98522 WP_003087865.1.98573 WP_003087865.1.98600 WP_003087865.1.98610 WP_003087865.1.98672 WP_003087865.1.98678 WP_003087865.1.98718 WP_003087865.1.98788 WP_003087865.1.98814 WP_003087865.1.9885 WP_003087865.1.98873 WP_003087865.1.98958 WP_003087865.1.98960 WP_003087865.1.98963 WP_003087865.1.99065 WP_003087865.1.99103 WP_003087865.1.99378 WP_003087865.1.99386 WP_003087865.1.99389 WP_003087865.1.99443 WP_003087865.1.99461 WP_003087865.1.99516 WP_003087865.1.99647 WP_003087865.1.99662 WP_003087865.1.99746 WP_003087865.1.99757 WP_003087865.1.99772 WP_003087865.1.99795 WP_003087865.1.99835 WP_003087865.1.9989 WP_003087865.1.99930 gi|15596981|ref|NP_250475.1| gi|218892264|ref|YP_002441131.1| gi|568310360|ref|YP_008982629.1| gi|558671291|ref|YP_008808001.1| gi|116049732|ref|YP_791461.1| gi|386065625|ref|YP_005980929.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]