SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 208963.PA14_49560 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  208963.PA14_49560
Domain Number 1 Region: 27-276
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-135
Family Exotoxin A, N-terminal domain 0.000000000294
Further Details:      
 
Domain Number 2 Region: 417-628
Classification Level Classification E-value
Superfamily ADP-ribosylation 3.05e-79
Family ADP-ribosylating toxins 0.00000000217
Further Details:      
 
Domain Number 3 Region: 277-416
Classification Level Classification E-value
Superfamily Exotoxin A, middle domain 5.23e-66
Family Exotoxin A, middle domain 0.000000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 208963.PA14_49560
Sequence length 635
Comment (Pseudomonas aeruginosa UCBPP-PA14)
Sequence
MHLIPHWIPLVASLGLLAGGSFASAAEEAFDLWNECAKACVLDLKDGVRSSRMSVDPAIA
DTNGQGVLHYSMVLEGGNDALKLAIDNALSITSDGLTIRLEGGVEPNKPVRYSYTRQARG
SWSLNWLVPIGHEKPSNIKVFIHELNAGNQLSHMSPIYTIEMGDELLAKLARDATFFVRA
HESNEMQPTLAISHAGVSVVMAQTQPRREKRWSEWASGKVLCLLDPLDGVYNYLAQQRCN
LDDTWEGKIYRVLAGNPAKHDLDIKPTVISHRLHFPEGGSLAALTAHQACHLPLETFTRH
RQPRGWEQLEQCGYPVQRLVALYLAARLSWNQVDQVIRNALASPGSGGDLGEAIREQPEQ
ARLALTLAAAESERFVRQGTGNDEASADVVSLTCPVAAGECAGPADSGDALLERNYPTGA
EFLGDGGDVSFSTRGTQNWTVERLLQAHRQLEERGYVFVGYHGTFLEAAQSIVFGGVRAR
SQDLDAIWRGFYIAGDPALAYGYAQDQEPDARGRIRNGALLRVYVPRSSLPGFYRTGLTL
AAPEAAGEVERLIGHPLPLRLDAITGPEEEGGRLETILGWPLAERTVVIPSAIPTDPRNV
GGDLDPSSIPDQEQAISALPDYASQPGKPSREDLK
Download sequence
Identical sequences A0A0H2Z8B0 A0A157VXG8
WP_003140553.1.100278 WP_003140553.1.10248 WP_003140553.1.10575 WP_003140553.1.10895 WP_003140553.1.11318 WP_003140553.1.12150 WP_003140553.1.13085 WP_003140553.1.13718 WP_003140553.1.13743 WP_003140553.1.14251 WP_003140553.1.16751 WP_003140553.1.16811 WP_003140553.1.17108 WP_003140553.1.17177 WP_003140553.1.17223 WP_003140553.1.18156 WP_003140553.1.18157 WP_003140553.1.18440 WP_003140553.1.18508 WP_003140553.1.18907 WP_003140553.1.19089 WP_003140553.1.19199 WP_003140553.1.19351 WP_003140553.1.19640 WP_003140553.1.2012 WP_003140553.1.20825 WP_003140553.1.20880 WP_003140553.1.20890 WP_003140553.1.24413 WP_003140553.1.2530 WP_003140553.1.28757 WP_003140553.1.30563 WP_003140553.1.30615 WP_003140553.1.31457 WP_003140553.1.31563 WP_003140553.1.31655 WP_003140553.1.32359 WP_003140553.1.33047 WP_003140553.1.33294 WP_003140553.1.33438 WP_003140553.1.33833 WP_003140553.1.34556 WP_003140553.1.35442 WP_003140553.1.35968 WP_003140553.1.36064 WP_003140553.1.36267 WP_003140553.1.373 WP_003140553.1.37571 WP_003140553.1.38023 WP_003140553.1.38816 WP_003140553.1.39765 WP_003140553.1.40442 WP_003140553.1.40984 WP_003140553.1.41110 WP_003140553.1.41429 WP_003140553.1.42316 WP_003140553.1.42499 WP_003140553.1.42870 WP_003140553.1.43286 WP_003140553.1.43756 WP_003140553.1.43998 WP_003140553.1.44486 WP_003140553.1.44725 WP_003140553.1.45604 WP_003140553.1.45700 WP_003140553.1.46306 WP_003140553.1.48472 WP_003140553.1.48851 WP_003140553.1.49108 WP_003140553.1.49806 WP_003140553.1.51957 WP_003140553.1.52500 WP_003140553.1.52850 WP_003140553.1.55387 WP_003140553.1.55813 WP_003140553.1.56626 WP_003140553.1.57020 WP_003140553.1.57369 WP_003140553.1.58200 WP_003140553.1.58360 WP_003140553.1.58510 WP_003140553.1.58800 WP_003140553.1.58944 WP_003140553.1.60472 WP_003140553.1.62703 WP_003140553.1.63739 WP_003140553.1.64544 WP_003140553.1.6461 WP_003140553.1.64886 WP_003140553.1.65312 WP_003140553.1.65457 WP_003140553.1.65632 WP_003140553.1.66155 WP_003140553.1.68172 WP_003140553.1.68499 WP_003140553.1.68979 WP_003140553.1.70537 WP_003140553.1.71249 WP_003140553.1.7163 WP_003140553.1.72920 WP_003140553.1.74281 WP_003140553.1.74326 WP_003140553.1.74685 WP_003140553.1.75431 WP_003140553.1.75603 WP_003140553.1.76077 WP_003140553.1.76141 WP_003140553.1.76775 WP_003140553.1.78118 WP_003140553.1.78288 WP_003140553.1.79754 WP_003140553.1.8038 WP_003140553.1.80683 WP_003140553.1.80785 WP_003140553.1.81426 WP_003140553.1.81470 WP_003140553.1.81856 WP_003140553.1.81874 WP_003140553.1.81927 WP_003140553.1.83440 WP_003140553.1.83460 WP_003140553.1.83503 WP_003140553.1.83540 WP_003140553.1.84558 WP_003140553.1.85150 WP_003140553.1.85638 WP_003140553.1.85920 WP_003140553.1.86796 WP_003140553.1.86970 WP_003140553.1.8785 WP_003140553.1.87888 WP_003140553.1.88540 WP_003140553.1.89480 WP_003140553.1.91392 WP_003140553.1.92630 WP_003140553.1.93568 WP_003140553.1.93889 WP_003140553.1.94078 WP_003140553.1.94333 WP_003140553.1.95782 WP_003140553.1.96058 WP_003140553.1.961 WP_003140553.1.985 WP_003140553.1.98873 WP_003140553.1.98963 WP_003140553.1.99065 WP_003140553.1.99378 WP_003140553.1.99772 gi|116049080|ref|YP_792118.1| 208963.PA14_49560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]