SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 208964.PA1167 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  208964.PA1167
Domain Number 1 Region: 3-222
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.38e-76
Family Alginate lyase 0.00000000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 208964.PA1167
Sequence length 223
Comment (Pseudomonas aeruginosa)
Sequence
MPDLSTWNLTIPQGRPAITISTSQLQRDYRSDYFQRTADGIRFWVPVNGSHTRNSEFPRS
ELRETLSSGRPYNWRYARADNWLEATLRIEAVPSTRRMIIGQIHSDGSNSGQAAPLVKLL
YQLRLDQGRVQALVRERPDDGGTRAYTLMDGIPLGQPFSYRIGVSRSGLLSVSVNGSALE
QQLDPQWAYQGLYFKAGLYLQDNRGPSSEGGRATFSELRVSHQ
Download sequence
Identical sequences A0A069Q454 A0A0H3QZH5 Q9I4H0
208964.PA1167 gi|15596364|ref|NP_249858.1| NP_249858.1.87394 WP_003106699.1.100276 WP_003106699.1.101506 WP_003106699.1.10179 WP_003106699.1.10257 WP_003106699.1.10529 WP_003106699.1.11058 WP_003106699.1.11754 WP_003106699.1.1187 WP_003106699.1.12302 WP_003106699.1.12561 WP_003106699.1.12687 WP_003106699.1.13315 WP_003106699.1.14096 WP_003106699.1.14424 WP_003106699.1.14640 WP_003106699.1.14754 WP_003106699.1.15130 WP_003106699.1.15379 WP_003106699.1.15602 WP_003106699.1.16239 WP_003106699.1.16242 WP_003106699.1.16279 WP_003106699.1.17162 WP_003106699.1.17370 WP_003106699.1.18653 WP_003106699.1.18852 WP_003106699.1.19260 WP_003106699.1.19552 WP_003106699.1.20929 WP_003106699.1.21302 WP_003106699.1.21358 WP_003106699.1.21718 WP_003106699.1.21782 WP_003106699.1.21801 WP_003106699.1.23331 WP_003106699.1.23512 WP_003106699.1.23523 WP_003106699.1.23559 WP_003106699.1.23739 WP_003106699.1.23769 WP_003106699.1.24879 WP_003106699.1.25033 WP_003106699.1.25067 WP_003106699.1.25075 WP_003106699.1.25179 WP_003106699.1.25191 WP_003106699.1.2529 WP_003106699.1.25477 WP_003106699.1.25695 WP_003106699.1.26489 WP_003106699.1.26906 WP_003106699.1.27939 WP_003106699.1.28258 WP_003106699.1.29096 WP_003106699.1.29472 WP_003106699.1.29481 WP_003106699.1.2961 WP_003106699.1.29753 WP_003106699.1.29848 WP_003106699.1.30000 WP_003106699.1.30475 WP_003106699.1.30614 WP_003106699.1.31103 WP_003106699.1.31565 WP_003106699.1.31939 WP_003106699.1.32137 WP_003106699.1.33822 WP_003106699.1.33824 WP_003106699.1.34191 WP_003106699.1.34317 WP_003106699.1.34401 WP_003106699.1.34625 WP_003106699.1.35231 WP_003106699.1.35325 WP_003106699.1.35480 WP_003106699.1.37818 WP_003106699.1.38003 WP_003106699.1.39452 WP_003106699.1.3998 WP_003106699.1.40541 WP_003106699.1.41291 WP_003106699.1.41618 WP_003106699.1.41625 WP_003106699.1.41773 WP_003106699.1.41871 WP_003106699.1.42856 WP_003106699.1.42917 WP_003106699.1.43593 WP_003106699.1.43673 WP_003106699.1.43783 WP_003106699.1.4398 WP_003106699.1.44213 WP_003106699.1.45818 WP_003106699.1.46093 WP_003106699.1.46623 WP_003106699.1.46866 WP_003106699.1.47158 WP_003106699.1.48141 WP_003106699.1.48413 WP_003106699.1.49360 WP_003106699.1.49500 WP_003106699.1.49566 WP_003106699.1.50180 WP_003106699.1.50653 WP_003106699.1.51136 WP_003106699.1.51889 WP_003106699.1.51943 WP_003106699.1.5226 WP_003106699.1.5235 WP_003106699.1.52355 WP_003106699.1.5260 WP_003106699.1.53169 WP_003106699.1.53287 WP_003106699.1.53427 WP_003106699.1.54133 WP_003106699.1.54140 WP_003106699.1.54462 WP_003106699.1.54571 WP_003106699.1.55347 WP_003106699.1.56196 WP_003106699.1.56348 WP_003106699.1.56632 WP_003106699.1.56768 WP_003106699.1.5731 WP_003106699.1.57480 WP_003106699.1.59249 WP_003106699.1.59724 WP_003106699.1.59870 WP_003106699.1.61222 WP_003106699.1.61549 WP_003106699.1.6173 WP_003106699.1.62035 WP_003106699.1.62357 WP_003106699.1.62635 WP_003106699.1.6280 WP_003106699.1.62834 WP_003106699.1.64885 WP_003106699.1.64983 WP_003106699.1.65066 WP_003106699.1.65196 WP_003106699.1.65227 WP_003106699.1.65304 WP_003106699.1.65334 WP_003106699.1.65549 WP_003106699.1.66165 WP_003106699.1.66364 WP_003106699.1.66721 WP_003106699.1.67545 WP_003106699.1.68317 WP_003106699.1.68638 WP_003106699.1.68800 WP_003106699.1.68857 WP_003106699.1.69534 WP_003106699.1.69599 WP_003106699.1.69819 WP_003106699.1.70561 WP_003106699.1.70991 WP_003106699.1.71385 WP_003106699.1.71799 WP_003106699.1.72346 WP_003106699.1.73135 WP_003106699.1.73455 WP_003106699.1.73860 WP_003106699.1.74072 WP_003106699.1.7408 WP_003106699.1.74175 WP_003106699.1.74604 WP_003106699.1.74629 WP_003106699.1.75277 WP_003106699.1.75792 WP_003106699.1.75935 WP_003106699.1.76145 WP_003106699.1.76399 WP_003106699.1.76441 WP_003106699.1.77490 WP_003106699.1.77769 WP_003106699.1.78437 WP_003106699.1.78795 WP_003106699.1.79177 WP_003106699.1.79431 WP_003106699.1.79544 WP_003106699.1.79631 WP_003106699.1.79862 WP_003106699.1.80645 WP_003106699.1.80846 WP_003106699.1.81591 WP_003106699.1.81728 WP_003106699.1.81771 WP_003106699.1.81784 WP_003106699.1.81834 WP_003106699.1.82127 WP_003106699.1.82328 WP_003106699.1.82604 WP_003106699.1.82882 WP_003106699.1.83534 WP_003106699.1.84003 WP_003106699.1.84174 WP_003106699.1.84203 WP_003106699.1.84439 WP_003106699.1.84715 WP_003106699.1.8484 WP_003106699.1.85018 WP_003106699.1.85059 WP_003106699.1.85633 WP_003106699.1.85788 WP_003106699.1.86386 WP_003106699.1.865 WP_003106699.1.86652 WP_003106699.1.867 WP_003106699.1.86785 WP_003106699.1.86947 WP_003106699.1.8749 WP_003106699.1.88388 WP_003106699.1.88517 WP_003106699.1.88550 WP_003106699.1.88679 WP_003106699.1.88750 WP_003106699.1.89669 WP_003106699.1.89776 WP_003106699.1.90141 WP_003106699.1.90224 WP_003106699.1.90940 WP_003106699.1.91204 WP_003106699.1.91416 WP_003106699.1.91563 WP_003106699.1.9191 WP_003106699.1.92175 WP_003106699.1.92321 WP_003106699.1.92587 WP_003106699.1.92589 WP_003106699.1.92839 WP_003106699.1.92894 WP_003106699.1.92924 WP_003106699.1.93144 WP_003106699.1.93250 WP_003106699.1.9349 WP_003106699.1.93848 WP_003106699.1.94285 WP_003106699.1.94814 WP_003106699.1.94896 WP_003106699.1.95217 WP_003106699.1.95305 WP_003106699.1.95536 WP_003106699.1.95668 WP_003106699.1.96041 WP_003106699.1.96357 WP_003106699.1.96434 WP_003106699.1.96506 WP_003106699.1.97126 WP_003106699.1.97877 WP_003106699.1.98260 WP_003106699.1.98600 WP_003106699.1.98926 WP_003106699.1.9951 WP_003106699.1.99835 WP_003106699.1.99930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]