SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 208964.PA2251 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  208964.PA2251
Domain Number - Region: 5-62
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00314
Family GalR/LacI-like bacterial regulator 0.04
Further Details:      
 
Domain Number - Region: 108-172
Classification Level Classification E-value
Superfamily TNF-like 0.0114
Family TNF-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 208964.PA2251
Sequence length 272
Comment (Pseudomonas aeruginosa)
Sequence
MSEHLGANLKLLCSHYRSISEVCRQLAINRAQFNKYLSGQSQPTPYNRKRIGDFFGVEDY
ELGLPPEQFARLIGARTSAQPRQPSNDPLLRLLQPLRAEAGDLGRYCGYYFEYANCMSVP
GSILLSLVHLYEEDGVFLFERQERQERTSSTDVQAEEWARCRYLGAAFQLQDRVFLIDYE
SLTLNEMSQTILIPSFKSRITRLNGLKMGVSSGDRRTPACSRVVWDYLGAEINRINAYRQ
VRLYRPDDPRIDEDIRQRLAAGSLRHGLLETE
Download sequence
Identical sequences Q9I1L8
NP_250941.1.87394 WP_003113730.1.18653 WP_003113730.1.24879 WP_003113730.1.26489 WP_003113730.1.35480 WP_003113730.1.41773 WP_003113730.1.41871 WP_003113730.1.47469 WP_003113730.1.48413 WP_003113730.1.48961 WP_003113730.1.50653 WP_003113730.1.55347 WP_003113730.1.62357 WP_003113730.1.65066 WP_003113730.1.68857 WP_003113730.1.73455 WP_003113730.1.81771 WP_003113730.1.84715 WP_003113730.1.92175 WP_003113730.1.98600 gi|15597447|ref|NP_250941.1| 208964.PA2251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]