SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 209261.t1868 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  209261.t1868
Domain Number - Region: 363-418
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.023
Family Glycosyl hydrolases family 16 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 209261.t1868
Sequence length 503
Comment (Salmonella enterica serovar Typhi Ty2)
Sequence
MAKNDFKPFATGKGANVTSQPDWEALPALLSGFTAGKASSAQVNKALRQASFIAAALAQY
TASKSGKDVLDDGDLSGFIAKMSAAFGKDFQTLDATLTALAGLATGADKLPYFTGNDTAG
QTDLTSVGRDIIGKASIADILTYLGLGETINLAKNAVPATRRVNSKPLTGDITLWASDVG
AISADAVGEITDNGTMASANAPGWWKVAVSNSDTVVDFPTYPGGSKLYSYGYLFVEKIGD
VWFQHYYAHIGANAKRQDWGTVPNTSRPWVIDYNTANKPSASDVGALPITGGRLNGPLSI
GTDNALGGNSIVLGDNDTGFKQNGDGILDTFANSQHTVRVAPGEMQVLGAIRAGDAKRMT
MTSSNNSVLNAQFHLWGDGNRPTVIELDDDQGWHLYSQRNTDGSIQFVVNGQVIPDNYGN
FDARYLTSGNVYTKGESDNRYVQNIQRGAPVWPGKVDEYGPAEAPAGCFLTQARHDPTTA
YGVTFAYRPLQMWVGNGWRTING
Download sequence
Identical sequences Q8XFD7
gi|488654386|ref|YP_007926189.1| gi|29142294|ref|NP_805636.1| gi|16759933|ref|NP_455550.1| gi|16760757|ref|NP_456374.1| gi|378960038|ref|YP_005217524.1| 209261.t1868 220341.STY1072 220341.STY2014 AE014613|CDS_1932316-1930805 AL513382|CDS_1048497-1050008 AL513382|CDS_1891515-1890004 NP_455550.1.84458 NP_456374.1.84458 WP_001681975.1.100008 WP_001681975.1.100036 WP_001681975.1.100079 WP_001681975.1.100196 WP_001681975.1.100284 WP_001681975.1.100313 WP_001681975.1.100314 WP_001681975.1.100321 WP_001681975.1.100354 WP_001681975.1.100421 WP_001681975.1.100446 WP_001681975.1.100450 WP_001681975.1.100592 WP_001681975.1.100610 WP_001681975.1.100732 WP_001681975.1.100733 WP_001681975.1.100739 WP_001681975.1.100764 WP_001681975.1.100799 WP_001681975.1.100941 WP_001681975.1.100953 WP_001681975.1.101011 WP_001681975.1.10108 WP_001681975.1.101226 WP_001681975.1.10124 WP_001681975.1.101271 WP_001681975.1.101312 WP_001681975.1.101322 WP_001681975.1.101374 WP_001681975.1.101616 WP_001681975.1.101890 WP_001681975.1.101941 WP_001681975.1.102050 WP_001681975.1.102087 WP_001681975.1.10338 WP_001681975.1.1038 WP_001681975.1.104 WP_001681975.1.10401 WP_001681975.1.10428 WP_001681975.1.10459 WP_001681975.1.10475 WP_001681975.1.10511 WP_001681975.1.10514 WP_001681975.1.10530 WP_001681975.1.10532 WP_001681975.1.10547 WP_001681975.1.10595 WP_001681975.1.10642 WP_001681975.1.10654 WP_001681975.1.10677 WP_001681975.1.10857 WP_001681975.1.10873 WP_001681975.1.10926 WP_001681975.1.10936 WP_001681975.1.11012 WP_001681975.1.11055 WP_001681975.1.11126 WP_001681975.1.11142 WP_001681975.1.11239 WP_001681975.1.11314 WP_001681975.1.11385 WP_001681975.1.1142 WP_001681975.1.11426 WP_001681975.1.11429 WP_001681975.1.11557 WP_001681975.1.11567 WP_001681975.1.11638 WP_001681975.1.11883 WP_001681975.1.11908 WP_001681975.1.11914 WP_001681975.1.12040 WP_001681975.1.12061 WP_001681975.1.1207 WP_001681975.1.12141 WP_001681975.1.12172 WP_001681975.1.12192 WP_001681975.1.1224 WP_001681975.1.12364 WP_001681975.1.12398 WP_001681975.1.12441 WP_001681975.1.12581 WP_001681975.1.12620 WP_001681975.1.12648 WP_001681975.1.12683 WP_001681975.1.12726 WP_001681975.1.12727 WP_001681975.1.12741 WP_001681975.1.12834 WP_001681975.1.13108 WP_001681975.1.13161 WP_001681975.1.1321 WP_001681975.1.13268 WP_001681975.1.13291 WP_001681975.1.133 WP_001681975.1.13314 WP_001681975.1.13338 WP_001681975.1.13342 WP_001681975.1.13352 WP_001681975.1.13406 WP_001681975.1.13440 WP_001681975.1.13443 WP_001681975.1.13476 WP_001681975.1.13599 WP_001681975.1.13686 WP_001681975.1.1372 WP_001681975.1.13732 WP_001681975.1.1382 WP_001681975.1.1397 WP_001681975.1.13972 WP_001681975.1.140 WP_001681975.1.1401 WP_001681975.1.1408 WP_001681975.1.14089 WP_001681975.1.14099 WP_001681975.1.14120 WP_001681975.1.14123 WP_001681975.1.14150 WP_001681975.1.14191 WP_001681975.1.14197 WP_001681975.1.14280 WP_001681975.1.14333 WP_001681975.1.14399 WP_001681975.1.14444 WP_001681975.1.14467 WP_001681975.1.14474 WP_001681975.1.14500 WP_001681975.1.14526 WP_001681975.1.14550 WP_001681975.1.14575 WP_001681975.1.14701 WP_001681975.1.14703 WP_001681975.1.14719 WP_001681975.1.1473 WP_001681975.1.14765 WP_001681975.1.14810 WP_001681975.1.14877 WP_001681975.1.14894 WP_001681975.1.14930 WP_001681975.1.14947 WP_001681975.1.14948 WP_001681975.1.15184 WP_001681975.1.15244 WP_001681975.1.15265 WP_001681975.1.15362 WP_001681975.1.15415 WP_001681975.1.15423 WP_001681975.1.15433 WP_001681975.1.15439 WP_001681975.1.15487 WP_001681975.1.15535 WP_001681975.1.15581 WP_001681975.1.15597 WP_001681975.1.15710 WP_001681975.1.15717 WP_001681975.1.15905 WP_001681975.1.15912 WP_001681975.1.15970 WP_001681975.1.16046 WP_001681975.1.16051 WP_001681975.1.16058 WP_001681975.1.16150 WP_001681975.1.16155 WP_001681975.1.1626 WP_001681975.1.16264 WP_001681975.1.16344 WP_001681975.1.16452 WP_001681975.1.16461 WP_001681975.1.16462 WP_001681975.1.16465 WP_001681975.1.16522 WP_001681975.1.16588 WP_001681975.1.16658 WP_001681975.1.16666 WP_001681975.1.16673 WP_001681975.1.1674 WP_001681975.1.16767 WP_001681975.1.16781 WP_001681975.1.16879 WP_001681975.1.16893 WP_001681975.1.16905 WP_001681975.1.16948 WP_001681975.1.17049 WP_001681975.1.17058 WP_001681975.1.17078 WP_001681975.1.17202 WP_001681975.1.17219 WP_001681975.1.1722 WP_001681975.1.17302 WP_001681975.1.17308 WP_001681975.1.17368 WP_001681975.1.17405 WP_001681975.1.17406 WP_001681975.1.17513 WP_001681975.1.17543 WP_001681975.1.17563 WP_001681975.1.17578 WP_001681975.1.17622 WP_001681975.1.17659 WP_001681975.1.17667 WP_001681975.1.17686 WP_001681975.1.17741 WP_001681975.1.17840 WP_001681975.1.17956 WP_001681975.1.18005 WP_001681975.1.1801 WP_001681975.1.18021 WP_001681975.1.18099 WP_001681975.1.18124 WP_001681975.1.18144 WP_001681975.1.18173 WP_001681975.1.18280 WP_001681975.1.18328 WP_001681975.1.18358 WP_001681975.1.18370 WP_001681975.1.18406 WP_001681975.1.18474 WP_001681975.1.18513 WP_001681975.1.18610 WP_001681975.1.18678 WP_001681975.1.18722 WP_001681975.1.18766 WP_001681975.1.1880 WP_001681975.1.1885 WP_001681975.1.18860 WP_001681975.1.18922 WP_001681975.1.18959 WP_001681975.1.19001 WP_001681975.1.19006 WP_001681975.1.19044 WP_001681975.1.19084 WP_001681975.1.19187 WP_001681975.1.19228 WP_001681975.1.19288 WP_001681975.1.19300 WP_001681975.1.19422 WP_001681975.1.19454 WP_001681975.1.19456 WP_001681975.1.19496 WP_001681975.1.19535 WP_001681975.1.19538 WP_001681975.1.19589 WP_001681975.1.19663 WP_001681975.1.19686 WP_001681975.1.19731 WP_001681975.1.19794 WP_001681975.1.1992 WP_001681975.1.19999 WP_001681975.1.20254 WP_001681975.1.20255 WP_001681975.1.20296 WP_001681975.1.20339 WP_001681975.1.20419 WP_001681975.1.20465 WP_001681975.1.20492 WP_001681975.1.2053 WP_001681975.1.20635 WP_001681975.1.20718 WP_001681975.1.2073 WP_001681975.1.20740 WP_001681975.1.20828 WP_001681975.1.2087 WP_001681975.1.20883 WP_001681975.1.20947 WP_001681975.1.20953 WP_001681975.1.21010 WP_001681975.1.2106 WP_001681975.1.21062 WP_001681975.1.21144 WP_001681975.1.21162 WP_001681975.1.21184 WP_001681975.1.21185 WP_001681975.1.21366 WP_001681975.1.21492 WP_001681975.1.2166 WP_001681975.1.21674 WP_001681975.1.21946 WP_001681975.1.21966 WP_001681975.1.22064 WP_001681975.1.22118 WP_001681975.1.22126 WP_001681975.1.2216 WP_001681975.1.22208 WP_001681975.1.2227 WP_001681975.1.22373 WP_001681975.1.22476 WP_001681975.1.22614 WP_001681975.1.22652 WP_001681975.1.22683 WP_001681975.1.2284 WP_001681975.1.22895 WP_001681975.1.22926 WP_001681975.1.22943 WP_001681975.1.22967 WP_001681975.1.23040 WP_001681975.1.23058 WP_001681975.1.23218 WP_001681975.1.2331 WP_001681975.1.2332 WP_001681975.1.23340 WP_001681975.1.23365 WP_001681975.1.23412 WP_001681975.1.23426 WP_001681975.1.23492 WP_001681975.1.23548 WP_001681975.1.23571 WP_001681975.1.23604 WP_001681975.1.23679 WP_001681975.1.23728 WP_001681975.1.2375 WP_001681975.1.23783 WP_001681975.1.23786 WP_001681975.1.23787 WP_001681975.1.23801 WP_001681975.1.24028 WP_001681975.1.24061 WP_001681975.1.24083 WP_001681975.1.24117 WP_001681975.1.24125 WP_001681975.1.24138 WP_001681975.1.24153 WP_001681975.1.24291 WP_001681975.1.24322 WP_001681975.1.24355 WP_001681975.1.24375 WP_001681975.1.24400 WP_001681975.1.24420 WP_001681975.1.24619 WP_001681975.1.24643 WP_001681975.1.24688 WP_001681975.1.24716 WP_001681975.1.2481 WP_001681975.1.24832 WP_001681975.1.24964 WP_001681975.1.25017 WP_001681975.1.25032 WP_001681975.1.25041 WP_001681975.1.25053 WP_001681975.1.25140 WP_001681975.1.25185 WP_001681975.1.25196 WP_001681975.1.25210 WP_001681975.1.25219 WP_001681975.1.25304 WP_001681975.1.25374 WP_001681975.1.25475 WP_001681975.1.25490 WP_001681975.1.25508 WP_001681975.1.25512 WP_001681975.1.25603 WP_001681975.1.2562 WP_001681975.1.25666 WP_001681975.1.25807 WP_001681975.1.25821 WP_001681975.1.25833 WP_001681975.1.25835 WP_001681975.1.25882 WP_001681975.1.25911 WP_001681975.1.25962 WP_001681975.1.25963 WP_001681975.1.26001 WP_001681975.1.26027 WP_001681975.1.26107 WP_001681975.1.2615 WP_001681975.1.26217 WP_001681975.1.26230 WP_001681975.1.26232 WP_001681975.1.26272 WP_001681975.1.26286 WP_001681975.1.26288 WP_001681975.1.26394 WP_001681975.1.26491 WP_001681975.1.2654 WP_001681975.1.26554 WP_001681975.1.26636 WP_001681975.1.26689 WP_001681975.1.2679 WP_001681975.1.26908 WP_001681975.1.2692 WP_001681975.1.26928 WP_001681975.1.270 WP_001681975.1.27008 WP_001681975.1.27027 WP_001681975.1.27070 WP_001681975.1.27077 WP_001681975.1.27086 WP_001681975.1.27087 WP_001681975.1.27111 WP_001681975.1.27115 WP_001681975.1.2713 WP_001681975.1.2717 WP_001681975.1.27228 WP_001681975.1.27282 WP_001681975.1.27285 WP_001681975.1.27309 WP_001681975.1.27329 WP_001681975.1.27361 WP_001681975.1.27565 WP_001681975.1.27595 WP_001681975.1.27598 WP_001681975.1.27706 WP_001681975.1.27775 WP_001681975.1.27785 WP_001681975.1.27900 WP_001681975.1.27928 WP_001681975.1.27945 WP_001681975.1.28004 WP_001681975.1.2809 WP_001681975.1.28155 WP_001681975.1.28198 WP_001681975.1.2822 WP_001681975.1.28229 WP_001681975.1.28384 WP_001681975.1.28386 WP_001681975.1.28395 WP_001681975.1.284 WP_001681975.1.2845 WP_001681975.1.28479 WP_001681975.1.28627 WP_001681975.1.28692 WP_001681975.1.2873 WP_001681975.1.28917 WP_001681975.1.28962 WP_001681975.1.29023 WP_001681975.1.29042 WP_001681975.1.2905 WP_001681975.1.2907 WP_001681975.1.29081 WP_001681975.1.29089 WP_001681975.1.29153 WP_001681975.1.29203 WP_001681975.1.29237 WP_001681975.1.29288 WP_001681975.1.29389 WP_001681975.1.29439 WP_001681975.1.2946 WP_001681975.1.29462 WP_001681975.1.29563 WP_001681975.1.29727 WP_001681975.1.29743 WP_001681975.1.29782 WP_001681975.1.29833 WP_001681975.1.29851 WP_001681975.1.29865 WP_001681975.1.29886 WP_001681975.1.29919 WP_001681975.1.2994 WP_001681975.1.29964 WP_001681975.1.29983 WP_001681975.1.30009 WP_001681975.1.30013 WP_001681975.1.3002 WP_001681975.1.30034 WP_001681975.1.30049 WP_001681975.1.30058 WP_001681975.1.30172 WP_001681975.1.30185 WP_001681975.1.30354 WP_001681975.1.30362 WP_001681975.1.3042 WP_001681975.1.30421 WP_001681975.1.30440 WP_001681975.1.30448 WP_001681975.1.30489 WP_001681975.1.30517 WP_001681975.1.30542 WP_001681975.1.30544 WP_001681975.1.30556 WP_001681975.1.30572 WP_001681975.1.30585 WP_001681975.1.30618 WP_001681975.1.30664 WP_001681975.1.30688 WP_001681975.1.30806 WP_001681975.1.30967 WP_001681975.1.31046 WP_001681975.1.31066 WP_001681975.1.31078 WP_001681975.1.31139 WP_001681975.1.31145 WP_001681975.1.31182 WP_001681975.1.31205 WP_001681975.1.3121 WP_001681975.1.31223 WP_001681975.1.31303 WP_001681975.1.3131 WP_001681975.1.31352 WP_001681975.1.31389 WP_001681975.1.31413 WP_001681975.1.31446 WP_001681975.1.31533 WP_001681975.1.31799 WP_001681975.1.31836 WP_001681975.1.31951 WP_001681975.1.32041 WP_001681975.1.32042 WP_001681975.1.3207 WP_001681975.1.32189 WP_001681975.1.32202 WP_001681975.1.32263 WP_001681975.1.32293 WP_001681975.1.32299 WP_001681975.1.32422 WP_001681975.1.32425 WP_001681975.1.32458 WP_001681975.1.32460 WP_001681975.1.32529 WP_001681975.1.32563 WP_001681975.1.32578 WP_001681975.1.32617 WP_001681975.1.3270 WP_001681975.1.32725 WP_001681975.1.32838 WP_001681975.1.32848 WP_001681975.1.32868 WP_001681975.1.3290 WP_001681975.1.32940 WP_001681975.1.32941 WP_001681975.1.3296 WP_001681975.1.32966 WP_001681975.1.32985 WP_001681975.1.33037 WP_001681975.1.3305 WP_001681975.1.33051 WP_001681975.1.33065 WP_001681975.1.33122 WP_001681975.1.3315 WP_001681975.1.33208 WP_001681975.1.33214 WP_001681975.1.33247 WP_001681975.1.33280 WP_001681975.1.33283 WP_001681975.1.33313 WP_001681975.1.33339 WP_001681975.1.33382 WP_001681975.1.33490 WP_001681975.1.33501 WP_001681975.1.33529 WP_001681975.1.3370 WP_001681975.1.33730 WP_001681975.1.33741 WP_001681975.1.33840 WP_001681975.1.3392 WP_001681975.1.33926 WP_001681975.1.33957 WP_001681975.1.33969 WP_001681975.1.34001 WP_001681975.1.34059 WP_001681975.1.34118 WP_001681975.1.34211 WP_001681975.1.34214 WP_001681975.1.34234 WP_001681975.1.34284 WP_001681975.1.34376 WP_001681975.1.34382 WP_001681975.1.34484 WP_001681975.1.34517 WP_001681975.1.34530 WP_001681975.1.34665 WP_001681975.1.34694 WP_001681975.1.34751 WP_001681975.1.34808 WP_001681975.1.34824 WP_001681975.1.34834 WP_001681975.1.34932 WP_001681975.1.34962 WP_001681975.1.35001 WP_001681975.1.35040 WP_001681975.1.35074 WP_001681975.1.35175 WP_001681975.1.35240 WP_001681975.1.35274 WP_001681975.1.35532 WP_001681975.1.35560 WP_001681975.1.3557 WP_001681975.1.35628 WP_001681975.1.3570 WP_001681975.1.35712 WP_001681975.1.35713 WP_001681975.1.35736 WP_001681975.1.35791 WP_001681975.1.35795 WP_001681975.1.35870 WP_001681975.1.35916 WP_001681975.1.35938 WP_001681975.1.35966 WP_001681975.1.36000 WP_001681975.1.36034 WP_001681975.1.36036 WP_001681975.1.36069 WP_001681975.1.36291 WP_001681975.1.36298 WP_001681975.1.36308 WP_001681975.1.36323 WP_001681975.1.36343 WP_001681975.1.36460 WP_001681975.1.3649 WP_001681975.1.36495 WP_001681975.1.36526 WP_001681975.1.36567 WP_001681975.1.36579 WP_001681975.1.36617 WP_001681975.1.36618 WP_001681975.1.36643 WP_001681975.1.36663 WP_001681975.1.36701 WP_001681975.1.36725 WP_001681975.1.36779 WP_001681975.1.36798 WP_001681975.1.36802 WP_001681975.1.36821 WP_001681975.1.36853 WP_001681975.1.36950 WP_001681975.1.37014 WP_001681975.1.37133 WP_001681975.1.37176 WP_001681975.1.37199 WP_001681975.1.37200 WP_001681975.1.37258 WP_001681975.1.37303 WP_001681975.1.37513 WP_001681975.1.37584 WP_001681975.1.37590 WP_001681975.1.37593 WP_001681975.1.37600 WP_001681975.1.37613 WP_001681975.1.37659 WP_001681975.1.37662 WP_001681975.1.37675 WP_001681975.1.37691 WP_001681975.1.37761 WP_001681975.1.37775 WP_001681975.1.37777 WP_001681975.1.378 WP_001681975.1.379 WP_001681975.1.37911 WP_001681975.1.37941 WP_001681975.1.37985 WP_001681975.1.38061 WP_001681975.1.38064 WP_001681975.1.3816 WP_001681975.1.38207 WP_001681975.1.38261 WP_001681975.1.38266 WP_001681975.1.38310 WP_001681975.1.3834 WP_001681975.1.38351 WP_001681975.1.3838 WP_001681975.1.38381 WP_001681975.1.38440 WP_001681975.1.38486 WP_001681975.1.38515 WP_001681975.1.38595 WP_001681975.1.3860 WP_001681975.1.38642 WP_001681975.1.38734 WP_001681975.1.38877 WP_001681975.1.38983 WP_001681975.1.38996 WP_001681975.1.39056 WP_001681975.1.3907 WP_001681975.1.39105 WP_001681975.1.3914 WP_001681975.1.39147 WP_001681975.1.39161 WP_001681975.1.39210 WP_001681975.1.39235 WP_001681975.1.3931 WP_001681975.1.39435 WP_001681975.1.39502 WP_001681975.1.39530 WP_001681975.1.39619 WP_001681975.1.39620 WP_001681975.1.39624 WP_001681975.1.39659 WP_001681975.1.39667 WP_001681975.1.39775 WP_001681975.1.39879 WP_001681975.1.39890 WP_001681975.1.39941 WP_001681975.1.39945 WP_001681975.1.39947 WP_001681975.1.40095 WP_001681975.1.40097 WP_001681975.1.401 WP_001681975.1.40160 WP_001681975.1.40167 WP_001681975.1.40279 WP_001681975.1.40361 WP_001681975.1.4042 WP_001681975.1.40467 WP_001681975.1.40496 WP_001681975.1.40517 WP_001681975.1.40698 WP_001681975.1.40750 WP_001681975.1.40763 WP_001681975.1.40854 WP_001681975.1.4089 WP_001681975.1.40924 WP_001681975.1.40932 WP_001681975.1.40946 WP_001681975.1.41004 WP_001681975.1.4106 WP_001681975.1.41070 WP_001681975.1.41074 WP_001681975.1.41075 WP_001681975.1.41097 WP_001681975.1.41132 WP_001681975.1.41176 WP_001681975.1.41251 WP_001681975.1.41258 WP_001681975.1.41305 WP_001681975.1.41321 WP_001681975.1.41333 WP_001681975.1.41335 WP_001681975.1.4136 WP_001681975.1.41415 WP_001681975.1.41459 WP_001681975.1.41498 WP_001681975.1.41519 WP_001681975.1.41524 WP_001681975.1.41631 WP_001681975.1.41658 WP_001681975.1.41659 WP_001681975.1.41716 WP_001681975.1.41746 WP_001681975.1.41824 WP_001681975.1.41825 WP_001681975.1.41836 WP_001681975.1.41894 WP_001681975.1.41919 WP_001681975.1.41929 WP_001681975.1.4194 WP_001681975.1.42069 WP_001681975.1.42081 WP_001681975.1.42090 WP_001681975.1.42111 WP_001681975.1.42187 WP_001681975.1.42200 WP_001681975.1.42219 WP_001681975.1.42257 WP_001681975.1.42261 WP_001681975.1.42349 WP_001681975.1.42364 WP_001681975.1.42371 WP_001681975.1.42379 WP_001681975.1.42391 WP_001681975.1.42399 WP_001681975.1.42539 WP_001681975.1.42603 WP_001681975.1.42650 WP_001681975.1.4267 WP_001681975.1.42701 WP_001681975.1.42805 WP_001681975.1.42815 WP_001681975.1.42859 WP_001681975.1.4298 WP_001681975.1.43008 WP_001681975.1.43016 WP_001681975.1.43019 WP_001681975.1.43065 WP_001681975.1.43068 WP_001681975.1.43069 WP_001681975.1.43128 WP_001681975.1.43141 WP_001681975.1.43157 WP_001681975.1.43161 WP_001681975.1.43190 WP_001681975.1.43198 WP_001681975.1.4326 WP_001681975.1.43290 WP_001681975.1.43307 WP_001681975.1.43513 WP_001681975.1.43633 WP_001681975.1.43637 WP_001681975.1.43651 WP_001681975.1.43722 WP_001681975.1.43801 WP_001681975.1.43812 WP_001681975.1.43888 WP_001681975.1.43919 WP_001681975.1.43974 WP_001681975.1.44049 WP_001681975.1.44101 WP_001681975.1.44160 WP_001681975.1.44180 WP_001681975.1.44196 WP_001681975.1.44248 WP_001681975.1.44262 WP_001681975.1.44268 WP_001681975.1.4427 WP_001681975.1.44296 WP_001681975.1.44343 WP_001681975.1.44351 WP_001681975.1.44360 WP_001681975.1.44416 WP_001681975.1.44431 WP_001681975.1.44437 WP_001681975.1.44546 WP_001681975.1.4468 WP_001681975.1.44762 WP_001681975.1.44815 WP_001681975.1.44828 WP_001681975.1.44879 WP_001681975.1.44917 WP_001681975.1.4501 WP_001681975.1.45072 WP_001681975.1.45093 WP_001681975.1.45136 WP_001681975.1.45241 WP_001681975.1.45435 WP_001681975.1.45523 WP_001681975.1.45596 WP_001681975.1.45648 WP_001681975.1.45829 WP_001681975.1.45871 WP_001681975.1.46030 WP_001681975.1.46077 WP_001681975.1.46169 WP_001681975.1.46225 WP_001681975.1.46241 WP_001681975.1.46307 WP_001681975.1.46355 WP_001681975.1.464 WP_001681975.1.46454 WP_001681975.1.46461 WP_001681975.1.46504 WP_001681975.1.46505 WP_001681975.1.46551 WP_001681975.1.46559 WP_001681975.1.46701 WP_001681975.1.46781 WP_001681975.1.46816 WP_001681975.1.46842 WP_001681975.1.4690 WP_001681975.1.46920 WP_001681975.1.46945 WP_001681975.1.47036 WP_001681975.1.47037 WP_001681975.1.47042 WP_001681975.1.47059 WP_001681975.1.47085 WP_001681975.1.47123 WP_001681975.1.47215 WP_001681975.1.47245 WP_001681975.1.47523 WP_001681975.1.47531 WP_001681975.1.47532 WP_001681975.1.47605 WP_001681975.1.47630 WP_001681975.1.4774 WP_001681975.1.47756 WP_001681975.1.4781 WP_001681975.1.47886 WP_001681975.1.47898 WP_001681975.1.48019 WP_001681975.1.48100 WP_001681975.1.48114 WP_001681975.1.48139 WP_001681975.1.48190 WP_001681975.1.48292 WP_001681975.1.48324 WP_001681975.1.48426 WP_001681975.1.48430 WP_001681975.1.48436 WP_001681975.1.48586 WP_001681975.1.4859 WP_001681975.1.48591 WP_001681975.1.48610 WP_001681975.1.48631 WP_001681975.1.48663 WP_001681975.1.48690 WP_001681975.1.48734 WP_001681975.1.48756 WP_001681975.1.48778 WP_001681975.1.48849 WP_001681975.1.48955 WP_001681975.1.48963 WP_001681975.1.48973 WP_001681975.1.49004 WP_001681975.1.49106 WP_001681975.1.49117 WP_001681975.1.49121 WP_001681975.1.4914 WP_001681975.1.49140 WP_001681975.1.49153 WP_001681975.1.49166 WP_001681975.1.49429 WP_001681975.1.49434 WP_001681975.1.49450 WP_001681975.1.495 WP_001681975.1.49545 WP_001681975.1.49703 WP_001681975.1.49769 WP_001681975.1.49846 WP_001681975.1.4991 WP_001681975.1.49947 WP_001681975.1.49959 WP_001681975.1.49997 WP_001681975.1.50014 WP_001681975.1.50030 WP_001681975.1.50043 WP_001681975.1.50103 WP_001681975.1.50158 WP_001681975.1.50308 WP_001681975.1.50309 WP_001681975.1.50387 WP_001681975.1.50406 WP_001681975.1.50468 WP_001681975.1.5051 WP_001681975.1.50566 WP_001681975.1.50570 WP_001681975.1.50626 WP_001681975.1.50726 WP_001681975.1.50771 WP_001681975.1.50875 WP_001681975.1.509 WP_001681975.1.50929 WP_001681975.1.50970 WP_001681975.1.51040 WP_001681975.1.51048 WP_001681975.1.51100 WP_001681975.1.51134 WP_001681975.1.51227 WP_001681975.1.5127 WP_001681975.1.51305 WP_001681975.1.51315 WP_001681975.1.5136 WP_001681975.1.51474 WP_001681975.1.51519 WP_001681975.1.51598 WP_001681975.1.51644 WP_001681975.1.51724 WP_001681975.1.51734 WP_001681975.1.51838 WP_001681975.1.51863 WP_001681975.1.51935 WP_001681975.1.52057 WP_001681975.1.52114 WP_001681975.1.52129 WP_001681975.1.52191 WP_001681975.1.52202 WP_001681975.1.52209 WP_001681975.1.52339 WP_001681975.1.52469 WP_001681975.1.52571 WP_001681975.1.526 WP_001681975.1.52647 WP_001681975.1.52742 WP_001681975.1.52773 WP_001681975.1.52795 WP_001681975.1.52807 WP_001681975.1.52887 WP_001681975.1.53092 WP_001681975.1.53141 WP_001681975.1.53151 WP_001681975.1.53154 WP_001681975.1.53159 WP_001681975.1.53210 WP_001681975.1.53233 WP_001681975.1.53307 WP_001681975.1.53321 WP_001681975.1.53368 WP_001681975.1.53375 WP_001681975.1.53450 WP_001681975.1.5349 WP_001681975.1.53540 WP_001681975.1.53555 WP_001681975.1.53559 WP_001681975.1.5356 WP_001681975.1.53571 WP_001681975.1.5358 WP_001681975.1.53692 WP_001681975.1.53723 WP_001681975.1.5374 WP_001681975.1.53750 WP_001681975.1.53800 WP_001681975.1.53815 WP_001681975.1.53839 WP_001681975.1.53892 WP_001681975.1.53898 WP_001681975.1.53902 WP_001681975.1.53958 WP_001681975.1.53981 WP_001681975.1.53984 WP_001681975.1.54132 WP_001681975.1.54170 WP_001681975.1.54175 WP_001681975.1.54203 WP_001681975.1.54259 WP_001681975.1.5430 WP_001681975.1.54371 WP_001681975.1.54442 WP_001681975.1.54482 WP_001681975.1.54589 WP_001681975.1.5462 WP_001681975.1.54667 WP_001681975.1.54678 WP_001681975.1.54681 WP_001681975.1.54748 WP_001681975.1.5481 WP_001681975.1.54865 WP_001681975.1.54935 WP_001681975.1.54979 WP_001681975.1.55010 WP_001681975.1.55034 WP_001681975.1.55163 WP_001681975.1.55165 WP_001681975.1.55215 WP_001681975.1.55290 WP_001681975.1.55310 WP_001681975.1.55317 WP_001681975.1.55379 WP_001681975.1.5539 WP_001681975.1.55468 WP_001681975.1.55604 WP_001681975.1.55639 WP_001681975.1.55699 WP_001681975.1.55725 WP_001681975.1.55780 WP_001681975.1.56144 WP_001681975.1.56172 WP_001681975.1.5621 WP_001681975.1.56226 WP_001681975.1.56311 WP_001681975.1.56419 WP_001681975.1.56423 WP_001681975.1.56514 WP_001681975.1.56535 WP_001681975.1.56585 WP_001681975.1.56640 WP_001681975.1.56724 WP_001681975.1.56825 WP_001681975.1.56887 WP_001681975.1.56889 WP_001681975.1.56981 WP_001681975.1.57101 WP_001681975.1.57137 WP_001681975.1.57147 WP_001681975.1.57179 WP_001681975.1.57186 WP_001681975.1.57342 WP_001681975.1.57684 WP_001681975.1.57699 WP_001681975.1.57785 WP_001681975.1.57800 WP_001681975.1.57873 WP_001681975.1.57965 WP_001681975.1.57972 WP_001681975.1.58008 WP_001681975.1.58044 WP_001681975.1.58081 WP_001681975.1.5809 WP_001681975.1.58132 WP_001681975.1.58173 WP_001681975.1.58191 WP_001681975.1.58194 WP_001681975.1.58252 WP_001681975.1.58261 WP_001681975.1.58274 WP_001681975.1.58282 WP_001681975.1.58324 WP_001681975.1.58326 WP_001681975.1.5836 WP_001681975.1.58485 WP_001681975.1.58537 WP_001681975.1.58568 WP_001681975.1.58583 WP_001681975.1.58652 WP_001681975.1.58663 WP_001681975.1.58724 WP_001681975.1.5875 WP_001681975.1.58796 WP_001681975.1.58807 WP_001681975.1.58883 WP_001681975.1.58898 WP_001681975.1.58949 WP_001681975.1.58963 WP_001681975.1.58970 WP_001681975.1.58974 WP_001681975.1.59020 WP_001681975.1.59043 WP_001681975.1.59056 WP_001681975.1.59061 WP_001681975.1.59064 WP_001681975.1.59282 WP_001681975.1.59299 WP_001681975.1.59313 WP_001681975.1.5949 WP_001681975.1.59501 WP_001681975.1.59510 WP_001681975.1.5969 WP_001681975.1.59751 WP_001681975.1.59827 WP_001681975.1.59829 WP_001681975.1.59847 WP_001681975.1.59863 WP_001681975.1.59969 WP_001681975.1.59994 WP_001681975.1.60045 WP_001681975.1.60076 WP_001681975.1.60114 WP_001681975.1.60154 WP_001681975.1.60168 WP_001681975.1.60192 WP_001681975.1.60199 WP_001681975.1.60212 WP_001681975.1.60253 WP_001681975.1.60322 WP_001681975.1.60324 WP_001681975.1.60356 WP_001681975.1.6038 WP_001681975.1.60380 WP_001681975.1.6041 WP_001681975.1.60424 WP_001681975.1.60481 WP_001681975.1.605 WP_001681975.1.6058 WP_001681975.1.60584 WP_001681975.1.6060 WP_001681975.1.60676 WP_001681975.1.60708 WP_001681975.1.60725 WP_001681975.1.60783 WP_001681975.1.60792 WP_001681975.1.60807 WP_001681975.1.60882 WP_001681975.1.60889 WP_001681975.1.60950 WP_001681975.1.6104 WP_001681975.1.61044 WP_001681975.1.61076 WP_001681975.1.61123 WP_001681975.1.61147 WP_001681975.1.61168 WP_001681975.1.61210 WP_001681975.1.61357 WP_001681975.1.61511 WP_001681975.1.61539 WP_001681975.1.61542 WP_001681975.1.61553 WP_001681975.1.61649 WP_001681975.1.61652 WP_001681975.1.61697 WP_001681975.1.61809 WP_001681975.1.61877 WP_001681975.1.61920 WP_001681975.1.62124 WP_001681975.1.62199 WP_001681975.1.62223 WP_001681975.1.62302 WP_001681975.1.62314 WP_001681975.1.62323 WP_001681975.1.62333 WP_001681975.1.62338 WP_001681975.1.62380 WP_001681975.1.62436 WP_001681975.1.62475 WP_001681975.1.62536 WP_001681975.1.62640 WP_001681975.1.62686 WP_001681975.1.62751 WP_001681975.1.62825 WP_001681975.1.62913 WP_001681975.1.62932 WP_001681975.1.62960 WP_001681975.1.63016 WP_001681975.1.63025 WP_001681975.1.63069 WP_001681975.1.63087 WP_001681975.1.63169 WP_001681975.1.63297 WP_001681975.1.63448 WP_001681975.1.63514 WP_001681975.1.63583 WP_001681975.1.63663 WP_001681975.1.63736 WP_001681975.1.63816 WP_001681975.1.63876 WP_001681975.1.6389 WP_001681975.1.63901 WP_001681975.1.63955 WP_001681975.1.63963 WP_001681975.1.64032 WP_001681975.1.64087 WP_001681975.1.6415 WP_001681975.1.64293 WP_001681975.1.64332 WP_001681975.1.64376 WP_001681975.1.644 WP_001681975.1.64471 WP_001681975.1.64501 WP_001681975.1.64538 WP_001681975.1.64632 WP_001681975.1.64648 WP_001681975.1.64654 WP_001681975.1.64662 WP_001681975.1.64663 WP_001681975.1.64709 WP_001681975.1.64710 WP_001681975.1.64744 WP_001681975.1.64763 WP_001681975.1.64817 WP_001681975.1.64847 WP_001681975.1.6487 WP_001681975.1.64891 WP_001681975.1.64974 WP_001681975.1.65054 WP_001681975.1.65075 WP_001681975.1.6514 WP_001681975.1.65172 WP_001681975.1.65191 WP_001681975.1.65200 WP_001681975.1.65211 WP_001681975.1.65218 WP_001681975.1.65226 WP_001681975.1.65249 WP_001681975.1.65266 WP_001681975.1.65395 WP_001681975.1.65459 WP_001681975.1.65463 WP_001681975.1.65487 WP_001681975.1.6549 WP_001681975.1.65499 WP_001681975.1.6554 WP_001681975.1.65650 WP_001681975.1.65697 WP_001681975.1.65699 WP_001681975.1.65737 WP_001681975.1.65755 WP_001681975.1.65812 WP_001681975.1.65846 WP_001681975.1.65863 WP_001681975.1.65985 WP_001681975.1.66021 WP_001681975.1.66031 WP_001681975.1.66052 WP_001681975.1.66064 WP_001681975.1.66109 WP_001681975.1.66145 WP_001681975.1.66183 WP_001681975.1.6620 WP_001681975.1.66216 WP_001681975.1.66273 WP_001681975.1.66324 WP_001681975.1.6634 WP_001681975.1.66361 WP_001681975.1.66480 WP_001681975.1.66665 WP_001681975.1.66681 WP_001681975.1.66684 WP_001681975.1.66755 WP_001681975.1.66759 WP_001681975.1.66801 WP_001681975.1.66860 WP_001681975.1.66953 WP_001681975.1.66955 WP_001681975.1.66981 WP_001681975.1.67024 WP_001681975.1.67042 WP_001681975.1.67101 WP_001681975.1.67143 WP_001681975.1.67201 WP_001681975.1.67211 WP_001681975.1.67237 WP_001681975.1.67336 WP_001681975.1.67339 WP_001681975.1.67387 WP_001681975.1.67394 WP_001681975.1.67397 WP_001681975.1.67403 WP_001681975.1.67430 WP_001681975.1.67442 WP_001681975.1.67539 WP_001681975.1.67556 WP_001681975.1.67576 WP_001681975.1.67604 WP_001681975.1.67619 WP_001681975.1.67625 WP_001681975.1.67627 WP_001681975.1.67641 WP_001681975.1.67657 WP_001681975.1.67673 WP_001681975.1.67700 WP_001681975.1.67718 WP_001681975.1.67729 WP_001681975.1.67774 WP_001681975.1.67820 WP_001681975.1.67910 WP_001681975.1.67954 WP_001681975.1.68 WP_001681975.1.68043 WP_001681975.1.68105 WP_001681975.1.68113 WP_001681975.1.68182 WP_001681975.1.6819 WP_001681975.1.68285 WP_001681975.1.68359 WP_001681975.1.68420 WP_001681975.1.68514 WP_001681975.1.68564 WP_001681975.1.68688 WP_001681975.1.68742 WP_001681975.1.68770 WP_001681975.1.68809 WP_001681975.1.68914 WP_001681975.1.69053 WP_001681975.1.69170 WP_001681975.1.69210 WP_001681975.1.69270 WP_001681975.1.69282 WP_001681975.1.69376 WP_001681975.1.69396 WP_001681975.1.69466 WP_001681975.1.69611 WP_001681975.1.69642 WP_001681975.1.69656 WP_001681975.1.69657 WP_001681975.1.69690 WP_001681975.1.69923 WP_001681975.1.69948 WP_001681975.1.69953 WP_001681975.1.70010 WP_001681975.1.70049 WP_001681975.1.70058 WP_001681975.1.70061 WP_001681975.1.70205 WP_001681975.1.70240 WP_001681975.1.70249 WP_001681975.1.70261 WP_001681975.1.70314 WP_001681975.1.7033 WP_001681975.1.70427 WP_001681975.1.70433 WP_001681975.1.70545 WP_001681975.1.70623 WP_001681975.1.70671 WP_001681975.1.70679 WP_001681975.1.70708 WP_001681975.1.70717 WP_001681975.1.70731 WP_001681975.1.70772 WP_001681975.1.70845 WP_001681975.1.70846 WP_001681975.1.70981 WP_001681975.1.70995 WP_001681975.1.71039 WP_001681975.1.71057 WP_001681975.1.71081 WP_001681975.1.71117 WP_001681975.1.71186 WP_001681975.1.71455 WP_001681975.1.71456 WP_001681975.1.71487 WP_001681975.1.71542 WP_001681975.1.71566 WP_001681975.1.71640 WP_001681975.1.71651 WP_001681975.1.71653 WP_001681975.1.71716 WP_001681975.1.71872 WP_001681975.1.71950 WP_001681975.1.71954 WP_001681975.1.71985 WP_001681975.1.72003 WP_001681975.1.72073 WP_001681975.1.72269 WP_001681975.1.72350 WP_001681975.1.72383 WP_001681975.1.72461 WP_001681975.1.72527 WP_001681975.1.7255 WP_001681975.1.72631 WP_001681975.1.72638 WP_001681975.1.72667 WP_001681975.1.72674 WP_001681975.1.72724 WP_001681975.1.72789 WP_001681975.1.72828 WP_001681975.1.72896 WP_001681975.1.72969 WP_001681975.1.72987 WP_001681975.1.73052 WP_001681975.1.7311 WP_001681975.1.73114 WP_001681975.1.73177 WP_001681975.1.73180 WP_001681975.1.73258 WP_001681975.1.73285 WP_001681975.1.7332 WP_001681975.1.7333 WP_001681975.1.73352 WP_001681975.1.73389 WP_001681975.1.73425 WP_001681975.1.73488 WP_001681975.1.73504 WP_001681975.1.7353 WP_001681975.1.73544 WP_001681975.1.73598 WP_001681975.1.7361 WP_001681975.1.73648 WP_001681975.1.73768 WP_001681975.1.73849 WP_001681975.1.73948 WP_001681975.1.73999 WP_001681975.1.74024 WP_001681975.1.74030 WP_001681975.1.74038 WP_001681975.1.74043 WP_001681975.1.74058 WP_001681975.1.74070 WP_001681975.1.74077 WP_001681975.1.74135 WP_001681975.1.74214 WP_001681975.1.74241 WP_001681975.1.74285 WP_001681975.1.7430 WP_001681975.1.74317 WP_001681975.1.74415 WP_001681975.1.74616 WP_001681975.1.74621 WP_001681975.1.74647 WP_001681975.1.74677 WP_001681975.1.74699 WP_001681975.1.74831 WP_001681975.1.74894 WP_001681975.1.74929 WP_001681975.1.74939 WP_001681975.1.74973 WP_001681975.1.7507 WP_001681975.1.75089 WP_001681975.1.75116 WP_001681975.1.75237 WP_001681975.1.75273 WP_001681975.1.75296 WP_001681975.1.75413 WP_001681975.1.75433 WP_001681975.1.75532 WP_001681975.1.75565 WP_001681975.1.75593 WP_001681975.1.75610 WP_001681975.1.75633 WP_001681975.1.75718 WP_001681975.1.75745 WP_001681975.1.75844 WP_001681975.1.75886 WP_001681975.1.75898 WP_001681975.1.76081 WP_001681975.1.76116 WP_001681975.1.76122 WP_001681975.1.76256 WP_001681975.1.76339 WP_001681975.1.76366 WP_001681975.1.76417 WP_001681975.1.7646 WP_001681975.1.76510 WP_001681975.1.76558 WP_001681975.1.76572 WP_001681975.1.76641 WP_001681975.1.76651 WP_001681975.1.76653 WP_001681975.1.76788 WP_001681975.1.76854 WP_001681975.1.76916 WP_001681975.1.76932 WP_001681975.1.76973 WP_001681975.1.76988 WP_001681975.1.77016 WP_001681975.1.77087 WP_001681975.1.77090 WP_001681975.1.77111 WP_001681975.1.77299 WP_001681975.1.77384 WP_001681975.1.77501 WP_001681975.1.77512 WP_001681975.1.77513 WP_001681975.1.77563 WP_001681975.1.77702 WP_001681975.1.77713 WP_001681975.1.7772 WP_001681975.1.77825 WP_001681975.1.77837 WP_001681975.1.77900 WP_001681975.1.77923 WP_001681975.1.77975 WP_001681975.1.78035 WP_001681975.1.78048 WP_001681975.1.78107 WP_001681975.1.78166 WP_001681975.1.78192 WP_001681975.1.78195 WP_001681975.1.78291 WP_001681975.1.78309 WP_001681975.1.78320 WP_001681975.1.78382 WP_001681975.1.78388 WP_001681975.1.78410 WP_001681975.1.7862 WP_001681975.1.78626 WP_001681975.1.78661 WP_001681975.1.78674 WP_001681975.1.78676 WP_001681975.1.78761 WP_001681975.1.789 WP_001681975.1.78993 WP_001681975.1.79012 WP_001681975.1.79069 WP_001681975.1.79074 WP_001681975.1.79098 WP_001681975.1.79155 WP_001681975.1.79164 WP_001681975.1.79204 WP_001681975.1.79280 WP_001681975.1.79397 WP_001681975.1.79456 WP_001681975.1.79532 WP_001681975.1.79547 WP_001681975.1.79654 WP_001681975.1.7970 WP_001681975.1.79722 WP_001681975.1.79772 WP_001681975.1.79880 WP_001681975.1.79916 WP_001681975.1.80065 WP_001681975.1.80103 WP_001681975.1.80273 WP_001681975.1.80282 WP_001681975.1.80354 WP_001681975.1.80368 WP_001681975.1.80386 WP_001681975.1.80400 WP_001681975.1.80462 WP_001681975.1.8049 WP_001681975.1.80492 WP_001681975.1.80569 WP_001681975.1.80664 WP_001681975.1.80696 WP_001681975.1.80984 WP_001681975.1.81131 WP_001681975.1.81187 WP_001681975.1.81262 WP_001681975.1.81268 WP_001681975.1.81269 WP_001681975.1.81271 WP_001681975.1.8131 WP_001681975.1.81333 WP_001681975.1.81342 WP_001681975.1.81364 WP_001681975.1.81494 WP_001681975.1.81557 WP_001681975.1.81676 WP_001681975.1.81681 WP_001681975.1.8170 WP_001681975.1.81763 WP_001681975.1.81855 WP_001681975.1.81921 WP_001681975.1.81931 WP_001681975.1.81936 WP_001681975.1.81949 WP_001681975.1.82070 WP_001681975.1.82076 WP_001681975.1.82131 WP_001681975.1.82156 WP_001681975.1.8218 WP_001681975.1.82180 WP_001681975.1.82201 WP_001681975.1.82214 WP_001681975.1.82225 WP_001681975.1.8240 WP_001681975.1.82408 WP_001681975.1.82416 WP_001681975.1.8242 WP_001681975.1.82456 WP_001681975.1.82465 WP_001681975.1.82473 WP_001681975.1.82553 WP_001681975.1.82646 WP_001681975.1.82670 WP_001681975.1.82731 WP_001681975.1.82812 WP_001681975.1.82850 WP_001681975.1.82872 WP_001681975.1.8294 WP_001681975.1.82959 WP_001681975.1.83007 WP_001681975.1.8304 WP_001681975.1.83180 WP_001681975.1.83229 WP_001681975.1.83235 WP_001681975.1.83290 WP_001681975.1.83333 WP_001681975.1.83657 WP_001681975.1.8375 WP_001681975.1.83923 WP_001681975.1.83994 WP_001681975.1.84 WP_001681975.1.8406 WP_001681975.1.84076 WP_001681975.1.84110 WP_001681975.1.84127 WP_001681975.1.84150 WP_001681975.1.84230 WP_001681975.1.84252 WP_001681975.1.8431 WP_001681975.1.84345 WP_001681975.1.84369 WP_001681975.1.84401 WP_001681975.1.84435 WP_001681975.1.84567 WP_001681975.1.84631 WP_001681975.1.84727 WP_001681975.1.84744 WP_001681975.1.84773 WP_001681975.1.84945 WP_001681975.1.84967 WP_001681975.1.85004 WP_001681975.1.8502 WP_001681975.1.85039 WP_001681975.1.85153 WP_001681975.1.85273 WP_001681975.1.85338 WP_001681975.1.85339 WP_001681975.1.85511 WP_001681975.1.85512 WP_001681975.1.8557 WP_001681975.1.85606 WP_001681975.1.85635 WP_001681975.1.85646 WP_001681975.1.85665 WP_001681975.1.85669 WP_001681975.1.85688 WP_001681975.1.85703 WP_001681975.1.85728 WP_001681975.1.85746 WP_001681975.1.85811 WP_001681975.1.859 WP_001681975.1.85917 WP_001681975.1.8594 WP_001681975.1.85977 WP_001681975.1.860 WP_001681975.1.8605 WP_001681975.1.86084 WP_001681975.1.8610 WP_001681975.1.8614 WP_001681975.1.86156 WP_001681975.1.86323 WP_001681975.1.86342 WP_001681975.1.8640 WP_001681975.1.8642 WP_001681975.1.86426 WP_001681975.1.86489 WP_001681975.1.86530 WP_001681975.1.86663 WP_001681975.1.86770 WP_001681975.1.86794 WP_001681975.1.86800 WP_001681975.1.86811 WP_001681975.1.86815 WP_001681975.1.86945 WP_001681975.1.86989 WP_001681975.1.87023 WP_001681975.1.87034 WP_001681975.1.87041 WP_001681975.1.87136 WP_001681975.1.87155 WP_001681975.1.87258 WP_001681975.1.87293 WP_001681975.1.87420 WP_001681975.1.87560 WP_001681975.1.8760 WP_001681975.1.87600 WP_001681975.1.87609 WP_001681975.1.87612 WP_001681975.1.87615 WP_001681975.1.87653 WP_001681975.1.87698 WP_001681975.1.87706 WP_001681975.1.87739 WP_001681975.1.87741 WP_001681975.1.87742 WP_001681975.1.87852 WP_001681975.1.87949 WP_001681975.1.88025 WP_001681975.1.88026 WP_001681975.1.8805 WP_001681975.1.8806 WP_001681975.1.881 WP_001681975.1.88145 WP_001681975.1.88199 WP_001681975.1.88299 WP_001681975.1.88313 WP_001681975.1.88359 WP_001681975.1.88407 WP_001681975.1.88414 WP_001681975.1.88444 WP_001681975.1.88446 WP_001681975.1.88458 WP_001681975.1.88538 WP_001681975.1.88547 WP_001681975.1.886 WP_001681975.1.88647 WP_001681975.1.88648 WP_001681975.1.88692 WP_001681975.1.88707 WP_001681975.1.88727 WP_001681975.1.88772 WP_001681975.1.88850 WP_001681975.1.8889 WP_001681975.1.88892 WP_001681975.1.88894 WP_001681975.1.89182 WP_001681975.1.89298 WP_001681975.1.89308 WP_001681975.1.89314 WP_001681975.1.89328 WP_001681975.1.89332 WP_001681975.1.89343 WP_001681975.1.89395 WP_001681975.1.8940 WP_001681975.1.89449 WP_001681975.1.8947 WP_001681975.1.89503 WP_001681975.1.89591 WP_001681975.1.89612 WP_001681975.1.89668 WP_001681975.1.89706 WP_001681975.1.89713 WP_001681975.1.89733 WP_001681975.1.89796 WP_001681975.1.89804 WP_001681975.1.89845 WP_001681975.1.89888 WP_001681975.1.89911 WP_001681975.1.8995 WP_001681975.1.89952 WP_001681975.1.90007 WP_001681975.1.9011 WP_001681975.1.90196 WP_001681975.1.90240 WP_001681975.1.90274 WP_001681975.1.90280 WP_001681975.1.90330 WP_001681975.1.90338 WP_001681975.1.90365 WP_001681975.1.90489 WP_001681975.1.90513 WP_001681975.1.90582 WP_001681975.1.90713 WP_001681975.1.90794 WP_001681975.1.90796 WP_001681975.1.90811 WP_001681975.1.9091 WP_001681975.1.91067 WP_001681975.1.91164 WP_001681975.1.91205 WP_001681975.1.91239 WP_001681975.1.91291 WP_001681975.1.91313 WP_001681975.1.9135 WP_001681975.1.91506 WP_001681975.1.91557 WP_001681975.1.91597 WP_001681975.1.91715 WP_001681975.1.9187 WP_001681975.1.91870 WP_001681975.1.92018 WP_001681975.1.92087 WP_001681975.1.92098 WP_001681975.1.92156 WP_001681975.1.92172 WP_001681975.1.92240 WP_001681975.1.92243 WP_001681975.1.92327 WP_001681975.1.92470 WP_001681975.1.92477 WP_001681975.1.92545 WP_001681975.1.92570 WP_001681975.1.92588 WP_001681975.1.926 WP_001681975.1.92633 WP_001681975.1.92649 WP_001681975.1.92676 WP_001681975.1.92705 WP_001681975.1.9271 WP_001681975.1.92734 WP_001681975.1.92823 WP_001681975.1.92987 WP_001681975.1.93007 WP_001681975.1.93022 WP_001681975.1.93103 WP_001681975.1.93105 WP_001681975.1.93111 WP_001681975.1.93121 WP_001681975.1.93168 WP_001681975.1.93184 WP_001681975.1.93221 WP_001681975.1.93223 WP_001681975.1.93239 WP_001681975.1.93302 WP_001681975.1.9336 WP_001681975.1.93387 WP_001681975.1.93469 WP_001681975.1.93511 WP_001681975.1.93512 WP_001681975.1.93635 WP_001681975.1.93657 WP_001681975.1.9374 WP_001681975.1.9375 WP_001681975.1.93754 WP_001681975.1.93780 WP_001681975.1.93828 WP_001681975.1.93842 WP_001681975.1.93843 WP_001681975.1.93875 WP_001681975.1.93909 WP_001681975.1.93919 WP_001681975.1.93938 WP_001681975.1.93984 WP_001681975.1.9399 WP_001681975.1.94017 WP_001681975.1.94079 WP_001681975.1.94097 WP_001681975.1.94107 WP_001681975.1.94142 WP_001681975.1.94215 WP_001681975.1.94303 WP_001681975.1.94365 WP_001681975.1.94390 WP_001681975.1.94415 WP_001681975.1.94492 WP_001681975.1.94510 WP_001681975.1.94527 WP_001681975.1.94573 WP_001681975.1.94579 WP_001681975.1.94586 WP_001681975.1.94593 WP_001681975.1.94650 WP_001681975.1.94659 WP_001681975.1.94662 WP_001681975.1.94700 WP_001681975.1.94745 WP_001681975.1.94815 WP_001681975.1.94820 WP_001681975.1.94850 WP_001681975.1.94851 WP_001681975.1.94864 WP_001681975.1.94952 WP_001681975.1.95006 WP_001681975.1.95055 WP_001681975.1.95076 WP_001681975.1.95099 WP_001681975.1.95165 WP_001681975.1.95239 WP_001681975.1.95246 WP_001681975.1.9525 WP_001681975.1.95255 WP_001681975.1.95265 WP_001681975.1.95338 WP_001681975.1.95530 WP_001681975.1.95547 WP_001681975.1.95590 WP_001681975.1.95625 WP_001681975.1.95675 WP_001681975.1.95716 WP_001681975.1.95776 WP_001681975.1.95884 WP_001681975.1.95890 WP_001681975.1.95906 WP_001681975.1.96025 WP_001681975.1.96044 WP_001681975.1.96054 WP_001681975.1.96094 WP_001681975.1.96127 WP_001681975.1.96144 WP_001681975.1.96188 WP_001681975.1.96211 WP_001681975.1.96212 WP_001681975.1.96319 WP_001681975.1.9633 WP_001681975.1.96359 WP_001681975.1.96539 WP_001681975.1.96552 WP_001681975.1.96610 WP_001681975.1.96625 WP_001681975.1.96635 WP_001681975.1.9664 WP_001681975.1.96675 WP_001681975.1.9670 WP_001681975.1.96750 WP_001681975.1.96792 WP_001681975.1.96801 WP_001681975.1.96803 WP_001681975.1.96925 WP_001681975.1.96938 WP_001681975.1.96946 WP_001681975.1.96957 WP_001681975.1.96978 WP_001681975.1.97026 WP_001681975.1.97028 WP_001681975.1.97079 WP_001681975.1.97154 WP_001681975.1.97184 WP_001681975.1.97287 WP_001681975.1.97291 WP_001681975.1.97422 WP_001681975.1.97441 WP_001681975.1.97505 WP_001681975.1.97599 WP_001681975.1.97606 WP_001681975.1.97615 WP_001681975.1.97646 WP_001681975.1.97690 WP_001681975.1.97819 WP_001681975.1.97938 WP_001681975.1.97986 WP_001681975.1.98036 WP_001681975.1.98080 WP_001681975.1.98086 WP_001681975.1.98158 WP_001681975.1.98263 WP_001681975.1.98418 WP_001681975.1.98448 WP_001681975.1.98457 WP_001681975.1.9850 WP_001681975.1.98502 WP_001681975.1.98607 WP_001681975.1.98731 WP_001681975.1.98762 WP_001681975.1.9877 WP_001681975.1.98801 WP_001681975.1.98818 WP_001681975.1.99163 WP_001681975.1.99335 WP_001681975.1.99350 WP_001681975.1.99360 WP_001681975.1.99363 WP_001681975.1.99369 WP_001681975.1.99388 WP_001681975.1.99397 WP_001681975.1.99463 WP_001681975.1.99483 WP_001681975.1.99546 WP_001681975.1.99579 WP_001681975.1.99595 WP_001681975.1.99676 WP_001681975.1.99764 WP_001681975.1.99829 WP_001681975.1.99837 WP_001681975.1.99841 WP_001681975.1.9992 WP_001681975.1.99996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]