SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 209261.t3200 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  209261.t3200
Domain Number 1 Region: 3-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.11e-49
Family Ribonuclease PH domain 1-like 0.0000143
Further Details:      
 
Domain Number 2 Region: 301-492
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.14e-46
Family Ribonuclease PH domain 1-like 0.0000178
Further Details:      
 
Domain Number 3 Region: 145-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.4e-31
Family Ribonuclease PH domain 2-like 0.00079
Further Details:      
 
Domain Number 4 Region: 450-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.68e-27
Family Ribonuclease PH domain 2-like 0.0000875
Further Details:      
 
Domain Number 5 Region: 226-325
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.11e-25
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0012
Further Details:      
 
Domain Number 6 Region: 554-639
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.93e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0042
Further Details:      
 
Domain Number 7 Region: 620-698
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.95e-22
Family Cold shock DNA-binding domain-like 0.0000353
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 209261.t3200
Sequence length 711
Comment (Salmonella enterica serovar Typhi Ty2)
Sequence
MLNPIVREFQYGQHTVTLETGMMARQATAAVMVSMDDTAVFVTVVGQKKAKPGQDFFPLT
VNYQERTYAAGRIPGSFFRREGRPSEGETLIARLIDRPVRPLFPEGFVNEVQVIATVVSV
NPQVNPDIVAMIGASAALSLSGIPFNGPIGAARVGYINDQYVLNPTQDELKESKLDLVVA
GTEAAVLMVESEAELLSEDTMLGAVVFGHEQQQVVIQAINDLVKEAGKPRWDWQPEAVND
ALNARVAALAESRLSDAYRITDKQERYAQVDVIKSETIEQLIAEDETLDANELGEILHAI
EKNVVRSRVLAGEPRIDGREKDMIRGLDVRTGVLPRTHGSALFTRGETQALVTATLGTAR
DAQVLDELMGERTDSFLFHYNFPPYSVGETGMVGSPKRREIGHGRLAKRGVLAVMPDMDK
FPYTVRVVSEITESNGSSSMASVCGASLALMDAGVPIKAAVAGIAMGLVKEGDNYVVLSD
ILGDEDHLGDMDFKVAGSRDGISALQMDIKIEGITKEIMQVALNQAKGARLHILGVMEQA
INAPRGDISEFAPRIHTIKISTDKIKDVIGKGGSVIRALTEETGTTIEIEDDGTVKIAAT
DGEKAKYAIRRIEEITAEIEVGRIYNSKVTRIVDFGAFVAIGGGKEGLVHISQIADKRVE
KVTDYLQMGQEVPVKVLEVDRQGRVRLSIKEATEQSQPAAAPEAPASEQAE
Download sequence
Identical sequences Q8Z3I0
gi|16762047|ref|NP_457664.1| AE014613|CDS_3292688-3290553 AL513382|CDS_3307193-3305058 gi|29143536|ref|NP_806878.1| NP_457664.1.84458 WP_010989243.1.100008 WP_010989243.1.100036 WP_010989243.1.100079 WP_010989243.1.100196 WP_010989243.1.100284 WP_010989243.1.100313 WP_010989243.1.100314 WP_010989243.1.100321 WP_010989243.1.100354 WP_010989243.1.100421 WP_010989243.1.100446 WP_010989243.1.100450 WP_010989243.1.100592 WP_010989243.1.100610 WP_010989243.1.100732 WP_010989243.1.100733 WP_010989243.1.100739 WP_010989243.1.100764 WP_010989243.1.100799 WP_010989243.1.100941 WP_010989243.1.100953 WP_010989243.1.101011 WP_010989243.1.10108 WP_010989243.1.10124 WP_010989243.1.101271 WP_010989243.1.101312 WP_010989243.1.101322 WP_010989243.1.101374 WP_010989243.1.101616 WP_010989243.1.101890 WP_010989243.1.101941 WP_010989243.1.102050 WP_010989243.1.102087 WP_010989243.1.10338 WP_010989243.1.1038 WP_010989243.1.104 WP_010989243.1.10401 WP_010989243.1.10428 WP_010989243.1.10459 WP_010989243.1.10475 WP_010989243.1.10511 WP_010989243.1.10514 WP_010989243.1.10530 WP_010989243.1.10532 WP_010989243.1.10547 WP_010989243.1.10595 WP_010989243.1.10642 WP_010989243.1.10654 WP_010989243.1.10677 WP_010989243.1.10857 WP_010989243.1.10873 WP_010989243.1.10926 WP_010989243.1.10936 WP_010989243.1.11012 WP_010989243.1.11055 WP_010989243.1.11126 WP_010989243.1.11142 WP_010989243.1.11239 WP_010989243.1.11253 WP_010989243.1.11314 WP_010989243.1.11385 WP_010989243.1.1142 WP_010989243.1.11426 WP_010989243.1.11429 WP_010989243.1.11557 WP_010989243.1.11567 WP_010989243.1.11638 WP_010989243.1.11883 WP_010989243.1.11908 WP_010989243.1.11914 WP_010989243.1.12040 WP_010989243.1.12061 WP_010989243.1.1207 WP_010989243.1.12141 WP_010989243.1.12172 WP_010989243.1.12192 WP_010989243.1.1224 WP_010989243.1.12364 WP_010989243.1.12398 WP_010989243.1.12441 WP_010989243.1.12581 WP_010989243.1.12620 WP_010989243.1.12648 WP_010989243.1.12683 WP_010989243.1.12726 WP_010989243.1.12727 WP_010989243.1.12741 WP_010989243.1.12834 WP_010989243.1.13108 WP_010989243.1.13161 WP_010989243.1.1321 WP_010989243.1.13268 WP_010989243.1.13291 WP_010989243.1.133 WP_010989243.1.13314 WP_010989243.1.13338 WP_010989243.1.13342 WP_010989243.1.13352 WP_010989243.1.13406 WP_010989243.1.13440 WP_010989243.1.13443 WP_010989243.1.13476 WP_010989243.1.13599 WP_010989243.1.13686 WP_010989243.1.1372 WP_010989243.1.13732 WP_010989243.1.1382 WP_010989243.1.1397 WP_010989243.1.13972 WP_010989243.1.140 WP_010989243.1.1401 WP_010989243.1.1408 WP_010989243.1.14089 WP_010989243.1.14099 WP_010989243.1.14120 WP_010989243.1.14123 WP_010989243.1.14150 WP_010989243.1.14191 WP_010989243.1.14197 WP_010989243.1.14280 WP_010989243.1.14333 WP_010989243.1.14399 WP_010989243.1.14444 WP_010989243.1.14467 WP_010989243.1.14474 WP_010989243.1.14500 WP_010989243.1.14526 WP_010989243.1.14550 WP_010989243.1.14575 WP_010989243.1.14701 WP_010989243.1.14703 WP_010989243.1.14719 WP_010989243.1.1473 WP_010989243.1.14765 WP_010989243.1.14810 WP_010989243.1.14877 WP_010989243.1.14894 WP_010989243.1.14930 WP_010989243.1.14947 WP_010989243.1.14948 WP_010989243.1.15184 WP_010989243.1.15244 WP_010989243.1.15265 WP_010989243.1.15362 WP_010989243.1.15415 WP_010989243.1.15423 WP_010989243.1.15433 WP_010989243.1.15439 WP_010989243.1.15487 WP_010989243.1.15535 WP_010989243.1.15581 WP_010989243.1.15597 WP_010989243.1.15710 WP_010989243.1.15717 WP_010989243.1.15905 WP_010989243.1.15912 WP_010989243.1.15970 WP_010989243.1.16046 WP_010989243.1.16051 WP_010989243.1.16058 WP_010989243.1.16150 WP_010989243.1.16155 WP_010989243.1.1626 WP_010989243.1.16264 WP_010989243.1.16344 WP_010989243.1.16452 WP_010989243.1.16461 WP_010989243.1.16462 WP_010989243.1.16465 WP_010989243.1.16522 WP_010989243.1.16588 WP_010989243.1.16658 WP_010989243.1.16666 WP_010989243.1.16673 WP_010989243.1.1674 WP_010989243.1.16767 WP_010989243.1.16781 WP_010989243.1.16879 WP_010989243.1.16893 WP_010989243.1.16905 WP_010989243.1.16948 WP_010989243.1.17049 WP_010989243.1.17058 WP_010989243.1.17078 WP_010989243.1.17202 WP_010989243.1.17219 WP_010989243.1.1722 WP_010989243.1.17302 WP_010989243.1.17308 WP_010989243.1.17368 WP_010989243.1.17405 WP_010989243.1.17406 WP_010989243.1.17513 WP_010989243.1.17543 WP_010989243.1.17563 WP_010989243.1.17578 WP_010989243.1.17622 WP_010989243.1.17659 WP_010989243.1.17667 WP_010989243.1.17686 WP_010989243.1.17741 WP_010989243.1.17840 WP_010989243.1.17956 WP_010989243.1.18005 WP_010989243.1.1801 WP_010989243.1.18021 WP_010989243.1.18099 WP_010989243.1.18124 WP_010989243.1.18144 WP_010989243.1.18173 WP_010989243.1.18270 WP_010989243.1.18280 WP_010989243.1.18328 WP_010989243.1.18358 WP_010989243.1.18370 WP_010989243.1.18406 WP_010989243.1.18474 WP_010989243.1.18513 WP_010989243.1.18610 WP_010989243.1.18678 WP_010989243.1.18722 WP_010989243.1.18766 WP_010989243.1.1880 WP_010989243.1.1885 WP_010989243.1.18860 WP_010989243.1.18922 WP_010989243.1.18959 WP_010989243.1.19001 WP_010989243.1.19006 WP_010989243.1.19044 WP_010989243.1.19084 WP_010989243.1.19187 WP_010989243.1.19228 WP_010989243.1.19288 WP_010989243.1.19300 WP_010989243.1.19422 WP_010989243.1.19454 WP_010989243.1.19456 WP_010989243.1.19496 WP_010989243.1.19535 WP_010989243.1.19538 WP_010989243.1.19589 WP_010989243.1.19663 WP_010989243.1.19686 WP_010989243.1.19731 WP_010989243.1.19794 WP_010989243.1.1992 WP_010989243.1.19999 WP_010989243.1.20254 WP_010989243.1.20255 WP_010989243.1.20296 WP_010989243.1.20339 WP_010989243.1.20419 WP_010989243.1.20465 WP_010989243.1.20492 WP_010989243.1.2053 WP_010989243.1.20635 WP_010989243.1.20718 WP_010989243.1.2073 WP_010989243.1.20740 WP_010989243.1.20828 WP_010989243.1.2087 WP_010989243.1.20883 WP_010989243.1.20947 WP_010989243.1.20953 WP_010989243.1.21010 WP_010989243.1.2106 WP_010989243.1.21062 WP_010989243.1.21144 WP_010989243.1.21162 WP_010989243.1.21184 WP_010989243.1.21185 WP_010989243.1.21366 WP_010989243.1.21492 WP_010989243.1.2166 WP_010989243.1.21674 WP_010989243.1.21946 WP_010989243.1.21966 WP_010989243.1.22064 WP_010989243.1.22118 WP_010989243.1.22126 WP_010989243.1.2216 WP_010989243.1.22208 WP_010989243.1.2227 WP_010989243.1.22373 WP_010989243.1.22476 WP_010989243.1.22614 WP_010989243.1.22652 WP_010989243.1.22683 WP_010989243.1.2284 WP_010989243.1.22895 WP_010989243.1.22926 WP_010989243.1.22943 WP_010989243.1.22967 WP_010989243.1.23040 WP_010989243.1.23058 WP_010989243.1.23218 WP_010989243.1.2331 WP_010989243.1.2332 WP_010989243.1.23340 WP_010989243.1.2336 WP_010989243.1.23365 WP_010989243.1.23412 WP_010989243.1.23426 WP_010989243.1.23492 WP_010989243.1.23515 WP_010989243.1.23548 WP_010989243.1.23571 WP_010989243.1.23604 WP_010989243.1.23679 WP_010989243.1.23728 WP_010989243.1.2375 WP_010989243.1.23783 WP_010989243.1.23786 WP_010989243.1.23787 WP_010989243.1.23801 WP_010989243.1.24028 WP_010989243.1.24061 WP_010989243.1.24083 WP_010989243.1.24117 WP_010989243.1.24125 WP_010989243.1.24138 WP_010989243.1.24153 WP_010989243.1.24291 WP_010989243.1.24322 WP_010989243.1.24355 WP_010989243.1.24375 WP_010989243.1.24400 WP_010989243.1.24420 WP_010989243.1.24619 WP_010989243.1.24643 WP_010989243.1.24688 WP_010989243.1.24716 WP_010989243.1.2481 WP_010989243.1.24832 WP_010989243.1.24964 WP_010989243.1.25017 WP_010989243.1.25032 WP_010989243.1.25041 WP_010989243.1.25053 WP_010989243.1.25140 WP_010989243.1.25185 WP_010989243.1.25196 WP_010989243.1.25210 WP_010989243.1.25219 WP_010989243.1.25304 WP_010989243.1.25374 WP_010989243.1.25475 WP_010989243.1.25490 WP_010989243.1.25508 WP_010989243.1.25512 WP_010989243.1.25603 WP_010989243.1.2562 WP_010989243.1.25666 WP_010989243.1.25807 WP_010989243.1.25821 WP_010989243.1.25833 WP_010989243.1.25835 WP_010989243.1.25882 WP_010989243.1.25911 WP_010989243.1.25962 WP_010989243.1.25963 WP_010989243.1.26001 WP_010989243.1.26027 WP_010989243.1.26107 WP_010989243.1.2615 WP_010989243.1.26217 WP_010989243.1.26230 WP_010989243.1.26232 WP_010989243.1.26272 WP_010989243.1.26286 WP_010989243.1.26288 WP_010989243.1.26394 WP_010989243.1.26491 WP_010989243.1.2654 WP_010989243.1.26554 WP_010989243.1.26636 WP_010989243.1.26689 WP_010989243.1.2679 WP_010989243.1.26908 WP_010989243.1.2692 WP_010989243.1.26928 WP_010989243.1.270 WP_010989243.1.27008 WP_010989243.1.27027 WP_010989243.1.27070 WP_010989243.1.27077 WP_010989243.1.27086 WP_010989243.1.27087 WP_010989243.1.27111 WP_010989243.1.27115 WP_010989243.1.2713 WP_010989243.1.2717 WP_010989243.1.27228 WP_010989243.1.27282 WP_010989243.1.27285 WP_010989243.1.27309 WP_010989243.1.27329 WP_010989243.1.27361 WP_010989243.1.27565 WP_010989243.1.27595 WP_010989243.1.27598 WP_010989243.1.27706 WP_010989243.1.27775 WP_010989243.1.27785 WP_010989243.1.27900 WP_010989243.1.27928 WP_010989243.1.27945 WP_010989243.1.28004 WP_010989243.1.2809 WP_010989243.1.28155 WP_010989243.1.28198 WP_010989243.1.2822 WP_010989243.1.28229 WP_010989243.1.28384 WP_010989243.1.28386 WP_010989243.1.28395 WP_010989243.1.284 WP_010989243.1.2845 WP_010989243.1.28479 WP_010989243.1.28627 WP_010989243.1.28692 WP_010989243.1.2873 WP_010989243.1.28917 WP_010989243.1.28962 WP_010989243.1.29023 WP_010989243.1.29042 WP_010989243.1.2905 WP_010989243.1.2907 WP_010989243.1.29081 WP_010989243.1.29089 WP_010989243.1.29153 WP_010989243.1.29203 WP_010989243.1.29237 WP_010989243.1.29248 WP_010989243.1.29288 WP_010989243.1.29389 WP_010989243.1.29439 WP_010989243.1.2946 WP_010989243.1.29462 WP_010989243.1.29563 WP_010989243.1.29727 WP_010989243.1.29743 WP_010989243.1.29782 WP_010989243.1.29833 WP_010989243.1.29851 WP_010989243.1.29865 WP_010989243.1.29886 WP_010989243.1.29919 WP_010989243.1.2994 WP_010989243.1.29964 WP_010989243.1.29983 WP_010989243.1.30009 WP_010989243.1.30013 WP_010989243.1.3002 WP_010989243.1.30034 WP_010989243.1.30049 WP_010989243.1.30058 WP_010989243.1.30172 WP_010989243.1.30185 WP_010989243.1.30354 WP_010989243.1.30357 WP_010989243.1.30362 WP_010989243.1.3042 WP_010989243.1.30421 WP_010989243.1.30440 WP_010989243.1.30448 WP_010989243.1.30489 WP_010989243.1.30517 WP_010989243.1.30542 WP_010989243.1.30544 WP_010989243.1.30556 WP_010989243.1.30572 WP_010989243.1.30585 WP_010989243.1.30618 WP_010989243.1.30664 WP_010989243.1.30688 WP_010989243.1.30806 WP_010989243.1.30967 WP_010989243.1.31046 WP_010989243.1.31066 WP_010989243.1.31078 WP_010989243.1.31139 WP_010989243.1.31145 WP_010989243.1.31182 WP_010989243.1.31205 WP_010989243.1.3121 WP_010989243.1.31223 WP_010989243.1.31303 WP_010989243.1.3131 WP_010989243.1.31352 WP_010989243.1.31389 WP_010989243.1.31413 WP_010989243.1.31446 WP_010989243.1.31533 WP_010989243.1.31799 WP_010989243.1.31836 WP_010989243.1.31951 WP_010989243.1.32041 WP_010989243.1.32042 WP_010989243.1.3207 WP_010989243.1.32189 WP_010989243.1.32202 WP_010989243.1.32263 WP_010989243.1.32293 WP_010989243.1.32299 WP_010989243.1.32422 WP_010989243.1.32425 WP_010989243.1.32458 WP_010989243.1.32460 WP_010989243.1.32529 WP_010989243.1.32563 WP_010989243.1.32578 WP_010989243.1.32617 WP_010989243.1.3270 WP_010989243.1.32725 WP_010989243.1.32838 WP_010989243.1.32848 WP_010989243.1.32868 WP_010989243.1.3290 WP_010989243.1.32940 WP_010989243.1.32941 WP_010989243.1.3296 WP_010989243.1.32966 WP_010989243.1.32985 WP_010989243.1.33037 WP_010989243.1.3305 WP_010989243.1.33051 WP_010989243.1.33122 WP_010989243.1.3315 WP_010989243.1.33208 WP_010989243.1.33214 WP_010989243.1.33247 WP_010989243.1.33280 WP_010989243.1.33283 WP_010989243.1.33313 WP_010989243.1.33339 WP_010989243.1.33382 WP_010989243.1.33490 WP_010989243.1.33501 WP_010989243.1.33529 WP_010989243.1.33689 WP_010989243.1.3370 WP_010989243.1.33730 WP_010989243.1.33741 WP_010989243.1.33840 WP_010989243.1.3392 WP_010989243.1.33926 WP_010989243.1.33957 WP_010989243.1.33969 WP_010989243.1.34001 WP_010989243.1.34059 WP_010989243.1.34118 WP_010989243.1.34211 WP_010989243.1.34214 WP_010989243.1.34234 WP_010989243.1.34284 WP_010989243.1.34376 WP_010989243.1.34382 WP_010989243.1.34484 WP_010989243.1.34517 WP_010989243.1.34530 WP_010989243.1.34665 WP_010989243.1.34694 WP_010989243.1.34751 WP_010989243.1.34808 WP_010989243.1.34824 WP_010989243.1.34834 WP_010989243.1.34932 WP_010989243.1.34962 WP_010989243.1.35001 WP_010989243.1.35040 WP_010989243.1.35074 WP_010989243.1.35175 WP_010989243.1.35240 WP_010989243.1.35274 WP_010989243.1.35532 WP_010989243.1.35560 WP_010989243.1.3557 WP_010989243.1.35628 WP_010989243.1.3570 WP_010989243.1.35712 WP_010989243.1.35713 WP_010989243.1.35736 WP_010989243.1.35791 WP_010989243.1.35795 WP_010989243.1.35870 WP_010989243.1.35916 WP_010989243.1.35938 WP_010989243.1.35966 WP_010989243.1.36000 WP_010989243.1.36034 WP_010989243.1.36036 WP_010989243.1.36069 WP_010989243.1.36291 WP_010989243.1.36298 WP_010989243.1.36308 WP_010989243.1.36323 WP_010989243.1.36343 WP_010989243.1.36460 WP_010989243.1.3649 WP_010989243.1.36495 WP_010989243.1.36526 WP_010989243.1.36567 WP_010989243.1.36579 WP_010989243.1.36617 WP_010989243.1.36618 WP_010989243.1.36643 WP_010989243.1.36663 WP_010989243.1.36701 WP_010989243.1.36725 WP_010989243.1.36779 WP_010989243.1.36798 WP_010989243.1.36802 WP_010989243.1.36821 WP_010989243.1.36853 WP_010989243.1.36950 WP_010989243.1.37014 WP_010989243.1.37133 WP_010989243.1.37176 WP_010989243.1.37199 WP_010989243.1.37200 WP_010989243.1.37258 WP_010989243.1.37303 WP_010989243.1.37513 WP_010989243.1.37584 WP_010989243.1.37590 WP_010989243.1.37593 WP_010989243.1.37600 WP_010989243.1.37613 WP_010989243.1.37659 WP_010989243.1.37662 WP_010989243.1.37675 WP_010989243.1.37691 WP_010989243.1.37761 WP_010989243.1.37775 WP_010989243.1.37777 WP_010989243.1.378 WP_010989243.1.379 WP_010989243.1.37911 WP_010989243.1.37941 WP_010989243.1.37985 WP_010989243.1.38061 WP_010989243.1.38064 WP_010989243.1.38108 WP_010989243.1.3816 WP_010989243.1.38207 WP_010989243.1.38261 WP_010989243.1.38266 WP_010989243.1.38310 WP_010989243.1.3834 WP_010989243.1.3838 WP_010989243.1.38381 WP_010989243.1.38440 WP_010989243.1.38486 WP_010989243.1.38515 WP_010989243.1.38595 WP_010989243.1.3860 WP_010989243.1.38642 WP_010989243.1.38734 WP_010989243.1.38877 WP_010989243.1.38983 WP_010989243.1.38996 WP_010989243.1.39056 WP_010989243.1.3907 WP_010989243.1.39105 WP_010989243.1.3914 WP_010989243.1.39147 WP_010989243.1.39161 WP_010989243.1.39210 WP_010989243.1.39235 WP_010989243.1.3931 WP_010989243.1.39435 WP_010989243.1.39502 WP_010989243.1.39530 WP_010989243.1.39619 WP_010989243.1.39620 WP_010989243.1.39624 WP_010989243.1.39659 WP_010989243.1.39667 WP_010989243.1.39775 WP_010989243.1.39879 WP_010989243.1.39890 WP_010989243.1.39941 WP_010989243.1.39945 WP_010989243.1.39947 WP_010989243.1.40095 WP_010989243.1.40097 WP_010989243.1.401 WP_010989243.1.40160 WP_010989243.1.40167 WP_010989243.1.40279 WP_010989243.1.40361 WP_010989243.1.4042 WP_010989243.1.40467 WP_010989243.1.40496 WP_010989243.1.40517 WP_010989243.1.40698 WP_010989243.1.40750 WP_010989243.1.40763 WP_010989243.1.40854 WP_010989243.1.4089 WP_010989243.1.40924 WP_010989243.1.40932 WP_010989243.1.40946 WP_010989243.1.41004 WP_010989243.1.4106 WP_010989243.1.41070 WP_010989243.1.41074 WP_010989243.1.41075 WP_010989243.1.41097 WP_010989243.1.41132 WP_010989243.1.41176 WP_010989243.1.41251 WP_010989243.1.41258 WP_010989243.1.41305 WP_010989243.1.41321 WP_010989243.1.41333 WP_010989243.1.41335 WP_010989243.1.4136 WP_010989243.1.41415 WP_010989243.1.41459 WP_010989243.1.41498 WP_010989243.1.41519 WP_010989243.1.41524 WP_010989243.1.41631 WP_010989243.1.41658 WP_010989243.1.41659 WP_010989243.1.41716 WP_010989243.1.41746 WP_010989243.1.41824 WP_010989243.1.41825 WP_010989243.1.41836 WP_010989243.1.41894 WP_010989243.1.41919 WP_010989243.1.41929 WP_010989243.1.4194 WP_010989243.1.42069 WP_010989243.1.42081 WP_010989243.1.42090 WP_010989243.1.42111 WP_010989243.1.42187 WP_010989243.1.42200 WP_010989243.1.42219 WP_010989243.1.42257 WP_010989243.1.42261 WP_010989243.1.42349 WP_010989243.1.42364 WP_010989243.1.42371 WP_010989243.1.42379 WP_010989243.1.42391 WP_010989243.1.42399 WP_010989243.1.42539 WP_010989243.1.42603 WP_010989243.1.42650 WP_010989243.1.4267 WP_010989243.1.42701 WP_010989243.1.42805 WP_010989243.1.42815 WP_010989243.1.42859 WP_010989243.1.4298 WP_010989243.1.43008 WP_010989243.1.43016 WP_010989243.1.43019 WP_010989243.1.43065 WP_010989243.1.43068 WP_010989243.1.43069 WP_010989243.1.43128 WP_010989243.1.43141 WP_010989243.1.43157 WP_010989243.1.43161 WP_010989243.1.43190 WP_010989243.1.43198 WP_010989243.1.4326 WP_010989243.1.43292 WP_010989243.1.43307 WP_010989243.1.43513 WP_010989243.1.43633 WP_010989243.1.43637 WP_010989243.1.43651 WP_010989243.1.43722 WP_010989243.1.43801 WP_010989243.1.43812 WP_010989243.1.43878 WP_010989243.1.43888 WP_010989243.1.43919 WP_010989243.1.43974 WP_010989243.1.44049 WP_010989243.1.44101 WP_010989243.1.44160 WP_010989243.1.44180 WP_010989243.1.44196 WP_010989243.1.44248 WP_010989243.1.44262 WP_010989243.1.44268 WP_010989243.1.4427 WP_010989243.1.44296 WP_010989243.1.44343 WP_010989243.1.44351 WP_010989243.1.44360 WP_010989243.1.44416 WP_010989243.1.44431 WP_010989243.1.44437 WP_010989243.1.44546 WP_010989243.1.4468 WP_010989243.1.44762 WP_010989243.1.44815 WP_010989243.1.44828 WP_010989243.1.44879 WP_010989243.1.44917 WP_010989243.1.4501 WP_010989243.1.45072 WP_010989243.1.45093 WP_010989243.1.45136 WP_010989243.1.45241 WP_010989243.1.45435 WP_010989243.1.45523 WP_010989243.1.45596 WP_010989243.1.45648 WP_010989243.1.45829 WP_010989243.1.45871 WP_010989243.1.46030 WP_010989243.1.46077 WP_010989243.1.46169 WP_010989243.1.46225 WP_010989243.1.46241 WP_010989243.1.46307 WP_010989243.1.46355 WP_010989243.1.464 WP_010989243.1.46454 WP_010989243.1.46461 WP_010989243.1.46504 WP_010989243.1.46505 WP_010989243.1.46551 WP_010989243.1.46559 WP_010989243.1.46701 WP_010989243.1.46781 WP_010989243.1.46816 WP_010989243.1.46842 WP_010989243.1.4690 WP_010989243.1.46920 WP_010989243.1.46945 WP_010989243.1.47036 WP_010989243.1.47037 WP_010989243.1.47042 WP_010989243.1.47059 WP_010989243.1.47085 WP_010989243.1.47123 WP_010989243.1.47215 WP_010989243.1.47245 WP_010989243.1.47523 WP_010989243.1.47531 WP_010989243.1.47532 WP_010989243.1.47605 WP_010989243.1.47630 WP_010989243.1.4774 WP_010989243.1.47756 WP_010989243.1.4781 WP_010989243.1.47886 WP_010989243.1.47898 WP_010989243.1.48019 WP_010989243.1.48100 WP_010989243.1.48114 WP_010989243.1.48139 WP_010989243.1.48190 WP_010989243.1.48292 WP_010989243.1.48324 WP_010989243.1.48426 WP_010989243.1.48430 WP_010989243.1.48436 WP_010989243.1.48586 WP_010989243.1.4859 WP_010989243.1.48591 WP_010989243.1.48610 WP_010989243.1.48631 WP_010989243.1.48663 WP_010989243.1.48690 WP_010989243.1.48734 WP_010989243.1.48756 WP_010989243.1.48778 WP_010989243.1.48849 WP_010989243.1.48955 WP_010989243.1.48963 WP_010989243.1.48973 WP_010989243.1.49004 WP_010989243.1.49106 WP_010989243.1.49117 WP_010989243.1.49121 WP_010989243.1.4914 WP_010989243.1.49140 WP_010989243.1.49153 WP_010989243.1.49166 WP_010989243.1.49355 WP_010989243.1.49429 WP_010989243.1.49434 WP_010989243.1.49450 WP_010989243.1.49545 WP_010989243.1.49703 WP_010989243.1.49846 WP_010989243.1.4991 WP_010989243.1.49947 WP_010989243.1.49959 WP_010989243.1.49997 WP_010989243.1.50014 WP_010989243.1.50030 WP_010989243.1.50043 WP_010989243.1.50103 WP_010989243.1.50158 WP_010989243.1.50247 WP_010989243.1.50308 WP_010989243.1.50309 WP_010989243.1.50387 WP_010989243.1.50406 WP_010989243.1.50468 WP_010989243.1.5051 WP_010989243.1.50566 WP_010989243.1.50570 WP_010989243.1.50626 WP_010989243.1.50726 WP_010989243.1.50771 WP_010989243.1.50875 WP_010989243.1.50885 WP_010989243.1.509 WP_010989243.1.50929 WP_010989243.1.50970 WP_010989243.1.51040 WP_010989243.1.51048 WP_010989243.1.51100 WP_010989243.1.51134 WP_010989243.1.51227 WP_010989243.1.5127 WP_010989243.1.51305 WP_010989243.1.51315 WP_010989243.1.5136 WP_010989243.1.51474 WP_010989243.1.51519 WP_010989243.1.51598 WP_010989243.1.51644 WP_010989243.1.51724 WP_010989243.1.51734 WP_010989243.1.51838 WP_010989243.1.51863 WP_010989243.1.51935 WP_010989243.1.52057 WP_010989243.1.52114 WP_010989243.1.52129 WP_010989243.1.52191 WP_010989243.1.52202 WP_010989243.1.52209 WP_010989243.1.52339 WP_010989243.1.52469 WP_010989243.1.52571 WP_010989243.1.526 WP_010989243.1.52647 WP_010989243.1.52742 WP_010989243.1.52773 WP_010989243.1.52795 WP_010989243.1.52807 WP_010989243.1.52887 WP_010989243.1.53092 WP_010989243.1.53141 WP_010989243.1.53151 WP_010989243.1.53154 WP_010989243.1.53159 WP_010989243.1.53210 WP_010989243.1.53233 WP_010989243.1.53307 WP_010989243.1.53321 WP_010989243.1.53368 WP_010989243.1.53375 WP_010989243.1.53450 WP_010989243.1.5349 WP_010989243.1.53540 WP_010989243.1.53555 WP_010989243.1.53559 WP_010989243.1.5356 WP_010989243.1.53571 WP_010989243.1.5358 WP_010989243.1.53692 WP_010989243.1.53723 WP_010989243.1.5374 WP_010989243.1.53750 WP_010989243.1.53800 WP_010989243.1.53815 WP_010989243.1.53839 WP_010989243.1.53892 WP_010989243.1.53898 WP_010989243.1.53902 WP_010989243.1.53958 WP_010989243.1.53981 WP_010989243.1.53984 WP_010989243.1.54132 WP_010989243.1.54170 WP_010989243.1.54175 WP_010989243.1.54203 WP_010989243.1.54259 WP_010989243.1.5430 WP_010989243.1.54371 WP_010989243.1.54431 WP_010989243.1.54442 WP_010989243.1.54482 WP_010989243.1.54589 WP_010989243.1.54667 WP_010989243.1.54678 WP_010989243.1.54681 WP_010989243.1.54748 WP_010989243.1.5481 WP_010989243.1.54865 WP_010989243.1.54935 WP_010989243.1.54979 WP_010989243.1.55010 WP_010989243.1.55034 WP_010989243.1.55163 WP_010989243.1.55165 WP_010989243.1.55215 WP_010989243.1.55290 WP_010989243.1.55310 WP_010989243.1.55317 WP_010989243.1.55379 WP_010989243.1.5539 WP_010989243.1.55468 WP_010989243.1.55506 WP_010989243.1.55604 WP_010989243.1.55639 WP_010989243.1.55699 WP_010989243.1.55725 WP_010989243.1.55780 WP_010989243.1.55967 WP_010989243.1.56144 WP_010989243.1.56172 WP_010989243.1.5621 WP_010989243.1.56226 WP_010989243.1.56311 WP_010989243.1.56419 WP_010989243.1.56423 WP_010989243.1.56514 WP_010989243.1.56535 WP_010989243.1.56585 WP_010989243.1.56640 WP_010989243.1.56724 WP_010989243.1.56825 WP_010989243.1.56887 WP_010989243.1.56889 WP_010989243.1.56981 WP_010989243.1.57101 WP_010989243.1.57137 WP_010989243.1.57147 WP_010989243.1.57179 WP_010989243.1.57186 WP_010989243.1.57342 WP_010989243.1.57684 WP_010989243.1.57699 WP_010989243.1.57785 WP_010989243.1.57800 WP_010989243.1.57873 WP_010989243.1.57965 WP_010989243.1.57972 WP_010989243.1.58008 WP_010989243.1.58044 WP_010989243.1.58081 WP_010989243.1.5809 WP_010989243.1.58132 WP_010989243.1.58173 WP_010989243.1.58191 WP_010989243.1.58194 WP_010989243.1.58252 WP_010989243.1.58261 WP_010989243.1.58274 WP_010989243.1.58282 WP_010989243.1.58324 WP_010989243.1.58326 WP_010989243.1.5836 WP_010989243.1.58485 WP_010989243.1.58537 WP_010989243.1.58568 WP_010989243.1.58583 WP_010989243.1.58652 WP_010989243.1.58663 WP_010989243.1.58724 WP_010989243.1.5875 WP_010989243.1.58796 WP_010989243.1.58807 WP_010989243.1.58847 WP_010989243.1.58883 WP_010989243.1.58898 WP_010989243.1.58949 WP_010989243.1.58963 WP_010989243.1.58970 WP_010989243.1.58974 WP_010989243.1.59020 WP_010989243.1.59043 WP_010989243.1.59056 WP_010989243.1.59061 WP_010989243.1.59064 WP_010989243.1.59282 WP_010989243.1.59299 WP_010989243.1.59313 WP_010989243.1.5949 WP_010989243.1.59501 WP_010989243.1.59510 WP_010989243.1.5969 WP_010989243.1.59751 WP_010989243.1.59827 WP_010989243.1.59829 WP_010989243.1.59847 WP_010989243.1.59863 WP_010989243.1.59969 WP_010989243.1.59994 WP_010989243.1.60045 WP_010989243.1.60076 WP_010989243.1.60114 WP_010989243.1.60154 WP_010989243.1.60168 WP_010989243.1.60192 WP_010989243.1.60199 WP_010989243.1.60212 WP_010989243.1.60253 WP_010989243.1.60322 WP_010989243.1.60324 WP_010989243.1.60356 WP_010989243.1.6038 WP_010989243.1.60380 WP_010989243.1.6041 WP_010989243.1.60424 WP_010989243.1.60481 WP_010989243.1.605 WP_010989243.1.6058 WP_010989243.1.60584 WP_010989243.1.6060 WP_010989243.1.60708 WP_010989243.1.60725 WP_010989243.1.60783 WP_010989243.1.60792 WP_010989243.1.60807 WP_010989243.1.60882 WP_010989243.1.60889 WP_010989243.1.60950 WP_010989243.1.6104 WP_010989243.1.61044 WP_010989243.1.61076 WP_010989243.1.61123 WP_010989243.1.61147 WP_010989243.1.61168 WP_010989243.1.61210 WP_010989243.1.61357 WP_010989243.1.61511 WP_010989243.1.61539 WP_010989243.1.61542 WP_010989243.1.61553 WP_010989243.1.61649 WP_010989243.1.61652 WP_010989243.1.61697 WP_010989243.1.61809 WP_010989243.1.61877 WP_010989243.1.61920 WP_010989243.1.62124 WP_010989243.1.62199 WP_010989243.1.62223 WP_010989243.1.62302 WP_010989243.1.62314 WP_010989243.1.62323 WP_010989243.1.62333 WP_010989243.1.62338 WP_010989243.1.62380 WP_010989243.1.62411 WP_010989243.1.62436 WP_010989243.1.62475 WP_010989243.1.62536 WP_010989243.1.62640 WP_010989243.1.62686 WP_010989243.1.62751 WP_010989243.1.62825 WP_010989243.1.62932 WP_010989243.1.62960 WP_010989243.1.63016 WP_010989243.1.63025 WP_010989243.1.63069 WP_010989243.1.63087 WP_010989243.1.63169 WP_010989243.1.63297 WP_010989243.1.63448 WP_010989243.1.63514 WP_010989243.1.63583 WP_010989243.1.63592 WP_010989243.1.63663 WP_010989243.1.63736 WP_010989243.1.63816 WP_010989243.1.63876 WP_010989243.1.6389 WP_010989243.1.63901 WP_010989243.1.63955 WP_010989243.1.63963 WP_010989243.1.64032 WP_010989243.1.64087 WP_010989243.1.6415 WP_010989243.1.64293 WP_010989243.1.64332 WP_010989243.1.64376 WP_010989243.1.644 WP_010989243.1.64471 WP_010989243.1.64501 WP_010989243.1.64538 WP_010989243.1.64632 WP_010989243.1.64648 WP_010989243.1.64654 WP_010989243.1.64662 WP_010989243.1.64663 WP_010989243.1.64709 WP_010989243.1.64710 WP_010989243.1.64744 WP_010989243.1.64763 WP_010989243.1.64817 WP_010989243.1.64847 WP_010989243.1.6487 WP_010989243.1.64891 WP_010989243.1.64974 WP_010989243.1.65054 WP_010989243.1.65075 WP_010989243.1.6514 WP_010989243.1.65172 WP_010989243.1.65191 WP_010989243.1.65200 WP_010989243.1.65211 WP_010989243.1.65218 WP_010989243.1.65226 WP_010989243.1.65249 WP_010989243.1.65266 WP_010989243.1.65395 WP_010989243.1.65459 WP_010989243.1.65463 WP_010989243.1.65487 WP_010989243.1.6549 WP_010989243.1.65499 WP_010989243.1.6554 WP_010989243.1.65650 WP_010989243.1.65697 WP_010989243.1.65699 WP_010989243.1.65737 WP_010989243.1.65755 WP_010989243.1.65812 WP_010989243.1.65846 WP_010989243.1.65863 WP_010989243.1.65985 WP_010989243.1.66021 WP_010989243.1.66031 WP_010989243.1.66052 WP_010989243.1.66064 WP_010989243.1.66109 WP_010989243.1.66145 WP_010989243.1.66183 WP_010989243.1.6620 WP_010989243.1.66216 WP_010989243.1.66234 WP_010989243.1.66273 WP_010989243.1.66324 WP_010989243.1.6634 WP_010989243.1.66361 WP_010989243.1.66480 WP_010989243.1.66506 WP_010989243.1.66665 WP_010989243.1.66681 WP_010989243.1.66684 WP_010989243.1.66755 WP_010989243.1.66759 WP_010989243.1.66801 WP_010989243.1.66860 WP_010989243.1.66953 WP_010989243.1.66955 WP_010989243.1.66981 WP_010989243.1.67024 WP_010989243.1.67042 WP_010989243.1.67101 WP_010989243.1.67143 WP_010989243.1.67201 WP_010989243.1.67211 WP_010989243.1.67237 WP_010989243.1.67336 WP_010989243.1.67339 WP_010989243.1.67387 WP_010989243.1.67394 WP_010989243.1.67397 WP_010989243.1.67403 WP_010989243.1.67430 WP_010989243.1.67442 WP_010989243.1.67539 WP_010989243.1.67556 WP_010989243.1.67576 WP_010989243.1.67604 WP_010989243.1.67619 WP_010989243.1.67625 WP_010989243.1.67627 WP_010989243.1.67641 WP_010989243.1.67657 WP_010989243.1.67673 WP_010989243.1.67700 WP_010989243.1.67718 WP_010989243.1.67729 WP_010989243.1.67774 WP_010989243.1.67820 WP_010989243.1.67910 WP_010989243.1.67954 WP_010989243.1.68 WP_010989243.1.68043 WP_010989243.1.68105 WP_010989243.1.68113 WP_010989243.1.68131 WP_010989243.1.68182 WP_010989243.1.6819 WP_010989243.1.68285 WP_010989243.1.68359 WP_010989243.1.68420 WP_010989243.1.68514 WP_010989243.1.68564 WP_010989243.1.68688 WP_010989243.1.68742 WP_010989243.1.68770 WP_010989243.1.68809 WP_010989243.1.68914 WP_010989243.1.69053 WP_010989243.1.69170 WP_010989243.1.69210 WP_010989243.1.69270 WP_010989243.1.69282 WP_010989243.1.69376 WP_010989243.1.69396 WP_010989243.1.69466 WP_010989243.1.69611 WP_010989243.1.69642 WP_010989243.1.69656 WP_010989243.1.69657 WP_010989243.1.69690 WP_010989243.1.69923 WP_010989243.1.69948 WP_010989243.1.69953 WP_010989243.1.70010 WP_010989243.1.70058 WP_010989243.1.70061 WP_010989243.1.70205 WP_010989243.1.70240 WP_010989243.1.70249 WP_010989243.1.70261 WP_010989243.1.7033 WP_010989243.1.70427 WP_010989243.1.70433 WP_010989243.1.70545 WP_010989243.1.70623 WP_010989243.1.70671 WP_010989243.1.70679 WP_010989243.1.70708 WP_010989243.1.70717 WP_010989243.1.70731 WP_010989243.1.70772 WP_010989243.1.70845 WP_010989243.1.70846 WP_010989243.1.70981 WP_010989243.1.70995 WP_010989243.1.71039 WP_010989243.1.71057 WP_010989243.1.71081 WP_010989243.1.71117 WP_010989243.1.71186 WP_010989243.1.71455 WP_010989243.1.71456 WP_010989243.1.71487 WP_010989243.1.71523 WP_010989243.1.71542 WP_010989243.1.71566 WP_010989243.1.71640 WP_010989243.1.71651 WP_010989243.1.71653 WP_010989243.1.71716 WP_010989243.1.71872 WP_010989243.1.71950 WP_010989243.1.71954 WP_010989243.1.71985 WP_010989243.1.72003 WP_010989243.1.72073 WP_010989243.1.72269 WP_010989243.1.72350 WP_010989243.1.72461 WP_010989243.1.72527 WP_010989243.1.7255 WP_010989243.1.72631 WP_010989243.1.72638 WP_010989243.1.72667 WP_010989243.1.72674 WP_010989243.1.72724 WP_010989243.1.72789 WP_010989243.1.72828 WP_010989243.1.72896 WP_010989243.1.72969 WP_010989243.1.72987 WP_010989243.1.7311 WP_010989243.1.73114 WP_010989243.1.73177 WP_010989243.1.73180 WP_010989243.1.73258 WP_010989243.1.73285 WP_010989243.1.7332 WP_010989243.1.7333 WP_010989243.1.73352 WP_010989243.1.73389 WP_010989243.1.73425 WP_010989243.1.73488 WP_010989243.1.73504 WP_010989243.1.7353 WP_010989243.1.73544 WP_010989243.1.73598 WP_010989243.1.7361 WP_010989243.1.73648 WP_010989243.1.73768 WP_010989243.1.73849 WP_010989243.1.73948 WP_010989243.1.73999 WP_010989243.1.74024 WP_010989243.1.74030 WP_010989243.1.74038 WP_010989243.1.74043 WP_010989243.1.74058 WP_010989243.1.74070 WP_010989243.1.74077 WP_010989243.1.74135 WP_010989243.1.74214 WP_010989243.1.74241 WP_010989243.1.74285 WP_010989243.1.7430 WP_010989243.1.74317 WP_010989243.1.74415 WP_010989243.1.74616 WP_010989243.1.74621 WP_010989243.1.74647 WP_010989243.1.74677 WP_010989243.1.74699 WP_010989243.1.74831 WP_010989243.1.74894 WP_010989243.1.74929 WP_010989243.1.74939 WP_010989243.1.74973 WP_010989243.1.7507 WP_010989243.1.75089 WP_010989243.1.75116 WP_010989243.1.75237 WP_010989243.1.75273 WP_010989243.1.75296 WP_010989243.1.75413 WP_010989243.1.75433 WP_010989243.1.75532 WP_010989243.1.75565 WP_010989243.1.75593 WP_010989243.1.75610 WP_010989243.1.75633 WP_010989243.1.75718 WP_010989243.1.75745 WP_010989243.1.75844 WP_010989243.1.75886 WP_010989243.1.75898 WP_010989243.1.76081 WP_010989243.1.76116 WP_010989243.1.76122 WP_010989243.1.76256 WP_010989243.1.76339 WP_010989243.1.76366 WP_010989243.1.76417 WP_010989243.1.7646 WP_010989243.1.76510 WP_010989243.1.76558 WP_010989243.1.76572 WP_010989243.1.76641 WP_010989243.1.76651 WP_010989243.1.76653 WP_010989243.1.76788 WP_010989243.1.76854 WP_010989243.1.76916 WP_010989243.1.76932 WP_010989243.1.76973 WP_010989243.1.76988 WP_010989243.1.77016 WP_010989243.1.77087 WP_010989243.1.77090 WP_010989243.1.77111 WP_010989243.1.77299 WP_010989243.1.77384 WP_010989243.1.77501 WP_010989243.1.77512 WP_010989243.1.77513 WP_010989243.1.77563 WP_010989243.1.77702 WP_010989243.1.77713 WP_010989243.1.7772 WP_010989243.1.77825 WP_010989243.1.77837 WP_010989243.1.77900 WP_010989243.1.77923 WP_010989243.1.77975 WP_010989243.1.78035 WP_010989243.1.78048 WP_010989243.1.78107 WP_010989243.1.78166 WP_010989243.1.78192 WP_010989243.1.78195 WP_010989243.1.78291 WP_010989243.1.78309 WP_010989243.1.78320 WP_010989243.1.78382 WP_010989243.1.78388 WP_010989243.1.78410 WP_010989243.1.7862 WP_010989243.1.78626 WP_010989243.1.78661 WP_010989243.1.78674 WP_010989243.1.78676 WP_010989243.1.78761 WP_010989243.1.789 WP_010989243.1.78993 WP_010989243.1.79012 WP_010989243.1.79069 WP_010989243.1.79074 WP_010989243.1.79098 WP_010989243.1.79155 WP_010989243.1.79164 WP_010989243.1.79204 WP_010989243.1.79280 WP_010989243.1.79397 WP_010989243.1.79456 WP_010989243.1.79532 WP_010989243.1.79547 WP_010989243.1.79654 WP_010989243.1.7970 WP_010989243.1.79722 WP_010989243.1.79772 WP_010989243.1.79880 WP_010989243.1.80065 WP_010989243.1.80103 WP_010989243.1.80273 WP_010989243.1.80282 WP_010989243.1.80354 WP_010989243.1.80368 WP_010989243.1.80386 WP_010989243.1.80400 WP_010989243.1.80462 WP_010989243.1.8049 WP_010989243.1.80492 WP_010989243.1.80569 WP_010989243.1.80664 WP_010989243.1.80696 WP_010989243.1.80984 WP_010989243.1.81131 WP_010989243.1.81187 WP_010989243.1.81262 WP_010989243.1.81268 WP_010989243.1.81269 WP_010989243.1.81271 WP_010989243.1.8131 WP_010989243.1.81333 WP_010989243.1.81342 WP_010989243.1.81364 WP_010989243.1.81494 WP_010989243.1.81557 WP_010989243.1.81676 WP_010989243.1.81681 WP_010989243.1.8170 WP_010989243.1.81763 WP_010989243.1.81855 WP_010989243.1.81921 WP_010989243.1.81931 WP_010989243.1.81936 WP_010989243.1.81949 WP_010989243.1.82070 WP_010989243.1.82076 WP_010989243.1.82131 WP_010989243.1.82156 WP_010989243.1.8218 WP_010989243.1.82180 WP_010989243.1.82201 WP_010989243.1.82214 WP_010989243.1.82225 WP_010989243.1.8240 WP_010989243.1.82408 WP_010989243.1.82416 WP_010989243.1.8242 WP_010989243.1.82456 WP_010989243.1.82465 WP_010989243.1.82473 WP_010989243.1.82553 WP_010989243.1.82646 WP_010989243.1.82670 WP_010989243.1.82731 WP_010989243.1.82812 WP_010989243.1.82850 WP_010989243.1.82872 WP_010989243.1.8294 WP_010989243.1.82959 WP_010989243.1.83007 WP_010989243.1.8304 WP_010989243.1.83180 WP_010989243.1.83229 WP_010989243.1.83235 WP_010989243.1.83290 WP_010989243.1.83333 WP_010989243.1.83657 WP_010989243.1.83677 WP_010989243.1.8375 WP_010989243.1.83923 WP_010989243.1.83994 WP_010989243.1.84 WP_010989243.1.8406 WP_010989243.1.84076 WP_010989243.1.84110 WP_010989243.1.84127 WP_010989243.1.84150 WP_010989243.1.84252 WP_010989243.1.8431 WP_010989243.1.84345 WP_010989243.1.84369 WP_010989243.1.84401 WP_010989243.1.84435 WP_010989243.1.84567 WP_010989243.1.84631 WP_010989243.1.84727 WP_010989243.1.84744 WP_010989243.1.84773 WP_010989243.1.84945 WP_010989243.1.85004 WP_010989243.1.8502 WP_010989243.1.85039 WP_010989243.1.85153 WP_010989243.1.85273 WP_010989243.1.85338 WP_010989243.1.85339 WP_010989243.1.85511 WP_010989243.1.85512 WP_010989243.1.8557 WP_010989243.1.85606 WP_010989243.1.85635 WP_010989243.1.85646 WP_010989243.1.85665 WP_010989243.1.85669 WP_010989243.1.85688 WP_010989243.1.85703 WP_010989243.1.85728 WP_010989243.1.85746 WP_010989243.1.85811 WP_010989243.1.859 WP_010989243.1.85917 WP_010989243.1.8594 WP_010989243.1.85977 WP_010989243.1.860 WP_010989243.1.8605 WP_010989243.1.86084 WP_010989243.1.8610 WP_010989243.1.8614 WP_010989243.1.86156 WP_010989243.1.86323 WP_010989243.1.86342 WP_010989243.1.8640 WP_010989243.1.8642 WP_010989243.1.86489 WP_010989243.1.86530 WP_010989243.1.86663 WP_010989243.1.86770 WP_010989243.1.86794 WP_010989243.1.86800 WP_010989243.1.86811 WP_010989243.1.86815 WP_010989243.1.86945 WP_010989243.1.86989 WP_010989243.1.87023 WP_010989243.1.87034 WP_010989243.1.87041 WP_010989243.1.87136 WP_010989243.1.87155 WP_010989243.1.87258 WP_010989243.1.87293 WP_010989243.1.87420 WP_010989243.1.87528 WP_010989243.1.87560 WP_010989243.1.8760 WP_010989243.1.87600 WP_010989243.1.87609 WP_010989243.1.87612 WP_010989243.1.87615 WP_010989243.1.87653 WP_010989243.1.87698 WP_010989243.1.87706 WP_010989243.1.87739 WP_010989243.1.87741 WP_010989243.1.87742 WP_010989243.1.87852 WP_010989243.1.87949 WP_010989243.1.88025 WP_010989243.1.88026 WP_010989243.1.8805 WP_010989243.1.8806 WP_010989243.1.881 WP_010989243.1.88145 WP_010989243.1.88199 WP_010989243.1.88299 WP_010989243.1.88313 WP_010989243.1.88359 WP_010989243.1.88407 WP_010989243.1.88414 WP_010989243.1.88444 WP_010989243.1.88446 WP_010989243.1.88458 WP_010989243.1.88501 WP_010989243.1.88538 WP_010989243.1.88547 WP_010989243.1.886 WP_010989243.1.88647 WP_010989243.1.88648 WP_010989243.1.88692 WP_010989243.1.88707 WP_010989243.1.88727 WP_010989243.1.88772 WP_010989243.1.88850 WP_010989243.1.8889 WP_010989243.1.88892 WP_010989243.1.88894 WP_010989243.1.89182 WP_010989243.1.89298 WP_010989243.1.89308 WP_010989243.1.89314 WP_010989243.1.89328 WP_010989243.1.89332 WP_010989243.1.89343 WP_010989243.1.89395 WP_010989243.1.8940 WP_010989243.1.89449 WP_010989243.1.8947 WP_010989243.1.89503 WP_010989243.1.89591 WP_010989243.1.89612 WP_010989243.1.89668 WP_010989243.1.89706 WP_010989243.1.89713 WP_010989243.1.89733 WP_010989243.1.89796 WP_010989243.1.89804 WP_010989243.1.89845 WP_010989243.1.89888 WP_010989243.1.89911 WP_010989243.1.8995 WP_010989243.1.89952 WP_010989243.1.90007 WP_010989243.1.9011 WP_010989243.1.90196 WP_010989243.1.90240 WP_010989243.1.90274 WP_010989243.1.90280 WP_010989243.1.90330 WP_010989243.1.90338 WP_010989243.1.90365 WP_010989243.1.90428 WP_010989243.1.90489 WP_010989243.1.90513 WP_010989243.1.90582 WP_010989243.1.90713 WP_010989243.1.90794 WP_010989243.1.90796 WP_010989243.1.90811 WP_010989243.1.9091 WP_010989243.1.91067 WP_010989243.1.91164 WP_010989243.1.91205 WP_010989243.1.91239 WP_010989243.1.91291 WP_010989243.1.91313 WP_010989243.1.9135 WP_010989243.1.91506 WP_010989243.1.91557 WP_010989243.1.91597 WP_010989243.1.91715 WP_010989243.1.9187 WP_010989243.1.91870 WP_010989243.1.92018 WP_010989243.1.92087 WP_010989243.1.92098 WP_010989243.1.92156 WP_010989243.1.92172 WP_010989243.1.92240 WP_010989243.1.92243 WP_010989243.1.92327 WP_010989243.1.92470 WP_010989243.1.92477 WP_010989243.1.92545 WP_010989243.1.92570 WP_010989243.1.92588 WP_010989243.1.926 WP_010989243.1.92633 WP_010989243.1.92649 WP_010989243.1.92676 WP_010989243.1.92705 WP_010989243.1.9271 WP_010989243.1.92734 WP_010989243.1.92810 WP_010989243.1.92823 WP_010989243.1.92987 WP_010989243.1.93007 WP_010989243.1.93022 WP_010989243.1.93103 WP_010989243.1.93105 WP_010989243.1.93111 WP_010989243.1.93121 WP_010989243.1.93168 WP_010989243.1.93184 WP_010989243.1.93221 WP_010989243.1.93223 WP_010989243.1.93239 WP_010989243.1.93302 WP_010989243.1.9336 WP_010989243.1.93387 WP_010989243.1.93469 WP_010989243.1.93511 WP_010989243.1.93512 WP_010989243.1.93657 WP_010989243.1.9374 WP_010989243.1.9375 WP_010989243.1.93754 WP_010989243.1.93780 WP_010989243.1.93828 WP_010989243.1.93842 WP_010989243.1.93843 WP_010989243.1.93875 WP_010989243.1.93909 WP_010989243.1.93919 WP_010989243.1.93938 WP_010989243.1.93984 WP_010989243.1.9399 WP_010989243.1.94017 WP_010989243.1.94079 WP_010989243.1.94097 WP_010989243.1.94107 WP_010989243.1.94142 WP_010989243.1.94215 WP_010989243.1.94303 WP_010989243.1.94365 WP_010989243.1.94390 WP_010989243.1.94415 WP_010989243.1.94492 WP_010989243.1.94510 WP_010989243.1.94527 WP_010989243.1.94573 WP_010989243.1.94579 WP_010989243.1.94586 WP_010989243.1.94593 WP_010989243.1.94650 WP_010989243.1.94659 WP_010989243.1.94662 WP_010989243.1.94700 WP_010989243.1.94745 WP_010989243.1.94782 WP_010989243.1.94815 WP_010989243.1.94820 WP_010989243.1.94850 WP_010989243.1.94851 WP_010989243.1.94864 WP_010989243.1.94952 WP_010989243.1.95006 WP_010989243.1.95055 WP_010989243.1.95076 WP_010989243.1.95099 WP_010989243.1.95165 WP_010989243.1.95239 WP_010989243.1.95246 WP_010989243.1.9525 WP_010989243.1.95255 WP_010989243.1.95265 WP_010989243.1.95338 WP_010989243.1.95412 WP_010989243.1.95530 WP_010989243.1.95547 WP_010989243.1.95590 WP_010989243.1.95625 WP_010989243.1.95675 WP_010989243.1.95716 WP_010989243.1.95776 WP_010989243.1.95884 WP_010989243.1.95890 WP_010989243.1.95906 WP_010989243.1.96025 WP_010989243.1.96044 WP_010989243.1.96054 WP_010989243.1.96094 WP_010989243.1.96127 WP_010989243.1.96144 WP_010989243.1.96188 WP_010989243.1.96211 WP_010989243.1.96212 WP_010989243.1.96319 WP_010989243.1.9633 WP_010989243.1.96359 WP_010989243.1.96539 WP_010989243.1.96552 WP_010989243.1.96610 WP_010989243.1.96625 WP_010989243.1.9664 WP_010989243.1.96675 WP_010989243.1.9670 WP_010989243.1.96750 WP_010989243.1.96792 WP_010989243.1.96801 WP_010989243.1.96803 WP_010989243.1.96938 WP_010989243.1.96946 WP_010989243.1.96957 WP_010989243.1.96978 WP_010989243.1.97026 WP_010989243.1.97028 WP_010989243.1.97079 WP_010989243.1.97154 WP_010989243.1.97184 WP_010989243.1.97287 WP_010989243.1.97291 WP_010989243.1.97422 WP_010989243.1.97441 WP_010989243.1.97497 WP_010989243.1.97505 WP_010989243.1.97599 WP_010989243.1.97606 WP_010989243.1.97615 WP_010989243.1.97646 WP_010989243.1.97690 WP_010989243.1.97819 WP_010989243.1.97840 WP_010989243.1.97938 WP_010989243.1.97986 WP_010989243.1.98036 WP_010989243.1.98080 WP_010989243.1.98086 WP_010989243.1.98158 WP_010989243.1.98263 WP_010989243.1.98418 WP_010989243.1.98448 WP_010989243.1.98457 WP_010989243.1.9850 WP_010989243.1.98502 WP_010989243.1.98607 WP_010989243.1.98731 WP_010989243.1.98762 WP_010989243.1.9877 WP_010989243.1.98801 WP_010989243.1.98818 WP_010989243.1.99163 WP_010989243.1.99335 WP_010989243.1.99350 WP_010989243.1.99360 WP_010989243.1.99363 WP_010989243.1.99369 WP_010989243.1.99388 WP_010989243.1.99397 WP_010989243.1.99463 WP_010989243.1.99483 WP_010989243.1.99546 WP_010989243.1.99579 WP_010989243.1.99595 WP_010989243.1.99671 WP_010989243.1.99676 WP_010989243.1.99764 WP_010989243.1.99829 WP_010989243.1.99837 WP_010989243.1.99841 WP_010989243.1.9992 WP_010989243.1.99996 209261.t3200 220341.STY3463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]