SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 210007.SMU.338 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  210007.SMU.338
Domain Number 1 Region: 261-318
Classification Level Classification E-value
Superfamily R3H domain 0.00000000129
Family R3H domain 0.0098
Further Details:      
 
Weak hits

Sequence:  210007.SMU.338
Domain Number - Region: 179-231
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 0.0146
Family Prokaryotic type KH domain (KH-domain type II) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 210007.SMU.338
Sequence length 322
Comment (Streptococcus mutans)
Sequence
MVLFTGKTVEEAIESGLKQMGISRMKAHIRVISREKKGFLGFGRKLARVEIEGINEKTAH
KADQKAVRGVPDSINKQNAPVSSSAEDTVALNHLSKTIKKLEKEDGQPLDKEIKEQVLEH
KISAQEMLEQNALTTKTSAATASSEAFNQKGKQTFEDFVADAFDEVDNGADIAVASKEVS
QYIQKIIYEMDLETSIETSHNRRQINLQIETPEAGRVIGYHGKVLKSLQLLAQNFLHDHY
SKHFSVTLNVHDYMEHRTKILIDFAHKIAKRVLDSGKAYQMDPMSNSERKVIHKTITGIE
GVESYSEGNDPNRYVVIASKGN
Download sequence
Identical sequences Q8DVX2
NP_720791.1.8892 WP_002310832.1.38244 WP_002310832.1.78804 210007.SMU.338 gi|24378836|ref|NP_720791.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]