SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 210007.SMU.72 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  210007.SMU.72
Domain Number 1 Region: 1-81
Classification Level Classification E-value
Superfamily ACT-like 1.86e-22
Family SP0238-like 0.0000725
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 210007.SMU.72
Sequence length 88
Comment (Streptococcus mutans)
Sequence
MKAIITVVGKDRTGIVAGVSTKIAELGLNIDDITQTVLDEYFTMMAVVSSQESQDFAQLR
KEFEAFGETLNVKINIQSSAIFDAMHNL
Download sequence
Identical sequences Q8DWH8
210007.SMU.72 WP_002263408.1.15378 WP_002263408.1.15966 WP_002263408.1.28418 WP_002263408.1.34420 WP_002263408.1.3499 WP_002263408.1.38244 WP_002263408.1.50881 WP_002263408.1.51119 WP_002263408.1.71645 WP_002263408.1.72550 WP_002263408.1.78804 WP_002263408.1.87803 WP_002263408.1.94193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]