SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 211110.gbs0295 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  211110.gbs0295
Domain Number 1 Region: 335-485
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 6.06e-28
Family HD domain 0.025
Further Details:      
 
Domain Number 2 Region: 223-319
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.47e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 211110.gbs0295
Sequence length 535
Comment (Streptococcus agalactiae NEM316)
Sequence
MFNIILAMVCALIGLIIGYVAISMKMKSSKEAAELTLLNAEQDAVDLRGKAEIEAEHIRK
AAERESKAHQKELLLEAKEEARKYREEIEKEFKSDRQELKQMEARLTDRASSLDRKDENL
SNKEKMLDSKEQSLTDKSRHINEREQEIATLETKKVEELSRIAELSQEEAKDIILADTEK
DLAHDIATRIKEAEREVKDRSNKIAKDLLAQAMQRLAGEYVTEQTITTVHLPDDNMKGRI
IGREGRNIRTLESLTGIDVIIDDTPEVVVLSGFDPIRREIARMTLESLIQDGRIHPARIE
ELVEKNRLEMDQRIREYGEAAAYEIGAPNLHPDLIKIMGRLQFRTSYGQNVLRHSVEVGK
LAGILAGELGENVDLARRAGFLHDMGKAIDREVEGSHVEIGMEFARKYKEHPIVVNTIAS
HHGDVEPDSVIAVIVAAADALSSARPGARNESMENYIKRLRDLEEIANGFEGVQNAFALQ
AGREIRIMVQPGKVSDDQVVIMSHKVREKIEQNLDYPGNIKVTVIREMRAVDFAK
Download sequence
Identical sequences A0A1F0C9U7 A0A1J7V8U8 E7S6C4 P67280 P67281 Q3K374 R4Z7X4 S8H6Z3 S8HAR2 S8HEL4 S8HHV2 S8HRN9 S9BBN0 S9CA27
205921.SAK_0377 208435.SAG0306 211110.gbs0295 gi|76787588|ref|YP_329029.1| gi|494702461|ref|YP_007967922.1| SaR77 gi|22536490|ref|NP_687341.1| gi|406708829|ref|YP_006763555.1| gi|25010369|ref|NP_734764.1| gi|512544016|ref|YP_008086129.1| gi|512538545|ref|YP_008084049.1| NP_687341.1.71890 WP_000481839.1.100037 WP_000481839.1.100093 WP_000481839.1.100254 WP_000481839.1.100267 WP_000481839.1.10029 WP_000481839.1.100367 WP_000481839.1.100520 WP_000481839.1.100641 WP_000481839.1.100766 WP_000481839.1.100913 WP_000481839.1.101195 WP_000481839.1.101208 WP_000481839.1.101222 WP_000481839.1.101267 WP_000481839.1.101283 WP_000481839.1.101296 WP_000481839.1.101319 WP_000481839.1.101830 WP_000481839.1.101853 WP_000481839.1.101864 WP_000481839.1.101956 WP_000481839.1.102056 WP_000481839.1.10371 WP_000481839.1.10618 WP_000481839.1.10620 WP_000481839.1.1067 WP_000481839.1.10676 WP_000481839.1.10723 WP_000481839.1.11343 WP_000481839.1.11465 WP_000481839.1.1163 WP_000481839.1.11756 WP_000481839.1.11941 WP_000481839.1.12102 WP_000481839.1.12166 WP_000481839.1.12249 WP_000481839.1.12331 WP_000481839.1.12363 WP_000481839.1.1251 WP_000481839.1.12619 WP_000481839.1.12688 WP_000481839.1.12755 WP_000481839.1.1293 WP_000481839.1.12978 WP_000481839.1.13008 WP_000481839.1.13064 WP_000481839.1.13167 WP_000481839.1.13285 WP_000481839.1.13384 WP_000481839.1.13493 WP_000481839.1.13553 WP_000481839.1.13658 WP_000481839.1.13737 WP_000481839.1.13885 WP_000481839.1.1402 WP_000481839.1.14275 WP_000481839.1.14324 WP_000481839.1.1437 WP_000481839.1.14429 WP_000481839.1.14563 WP_000481839.1.14738 WP_000481839.1.14953 WP_000481839.1.14960 WP_000481839.1.15199 WP_000481839.1.15417 WP_000481839.1.15526 WP_000481839.1.15556 WP_000481839.1.16134 WP_000481839.1.16165 WP_000481839.1.16335 WP_000481839.1.16342 WP_000481839.1.16535 WP_000481839.1.16595 WP_000481839.1.16706 WP_000481839.1.1681 WP_000481839.1.1696 WP_000481839.1.16976 WP_000481839.1.17056 WP_000481839.1.17243 WP_000481839.1.17339 WP_000481839.1.17489 WP_000481839.1.1760 WP_000481839.1.17707 WP_000481839.1.1775 WP_000481839.1.17815 WP_000481839.1.18003 WP_000481839.1.18047 WP_000481839.1.18362 WP_000481839.1.18425 WP_000481839.1.18450 WP_000481839.1.18747 WP_000481839.1.1882 WP_000481839.1.18829 WP_000481839.1.18841 WP_000481839.1.18933 WP_000481839.1.19073 WP_000481839.1.19086 WP_000481839.1.19604 WP_000481839.1.19892 WP_000481839.1.19950 WP_000481839.1.20123 WP_000481839.1.20188 WP_000481839.1.20258 WP_000481839.1.20326 WP_000481839.1.20350 WP_000481839.1.20435 WP_000481839.1.20458 WP_000481839.1.20511 WP_000481839.1.20726 WP_000481839.1.20791 WP_000481839.1.20847 WP_000481839.1.21087 WP_000481839.1.21280 WP_000481839.1.21522 WP_000481839.1.21525 WP_000481839.1.21669 WP_000481839.1.21722 WP_000481839.1.21779 WP_000481839.1.22004 WP_000481839.1.22076 WP_000481839.1.22087 WP_000481839.1.22139 WP_000481839.1.222 WP_000481839.1.22247 WP_000481839.1.22749 WP_000481839.1.22801 WP_000481839.1.23126 WP_000481839.1.23380 WP_000481839.1.23384 WP_000481839.1.24296 WP_000481839.1.24441 WP_000481839.1.24475 WP_000481839.1.24559 WP_000481839.1.24827 WP_000481839.1.24845 WP_000481839.1.25182 WP_000481839.1.25303 WP_000481839.1.2555 WP_000481839.1.25647 WP_000481839.1.25670 WP_000481839.1.25781 WP_000481839.1.25949 WP_000481839.1.25973 WP_000481839.1.25998 WP_000481839.1.26029 WP_000481839.1.26046 WP_000481839.1.26056 WP_000481839.1.26153 WP_000481839.1.26258 WP_000481839.1.26300 WP_000481839.1.26357 WP_000481839.1.2651 WP_000481839.1.26791 WP_000481839.1.26827 WP_000481839.1.27024 WP_000481839.1.27184 WP_000481839.1.27318 WP_000481839.1.27325 WP_000481839.1.2754 WP_000481839.1.27583 WP_000481839.1.27751 WP_000481839.1.2781 WP_000481839.1.27880 WP_000481839.1.27958 WP_000481839.1.28021 WP_000481839.1.28197 WP_000481839.1.28342 WP_000481839.1.2844 WP_000481839.1.28613 WP_000481839.1.28630 WP_000481839.1.28738 WP_000481839.1.28991 WP_000481839.1.29020 WP_000481839.1.29163 WP_000481839.1.29238 WP_000481839.1.29352 WP_000481839.1.29719 WP_000481839.1.29771 WP_000481839.1.29888 WP_000481839.1.30062 WP_000481839.1.30200 WP_000481839.1.30252 WP_000481839.1.3028 WP_000481839.1.30321 WP_000481839.1.30388 WP_000481839.1.3052 WP_000481839.1.30603 WP_000481839.1.30703 WP_000481839.1.30710 WP_000481839.1.3074 WP_000481839.1.30831 WP_000481839.1.30974 WP_000481839.1.31109 WP_000481839.1.3112 WP_000481839.1.3166 WP_000481839.1.31888 WP_000481839.1.31894 WP_000481839.1.32053 WP_000481839.1.32511 WP_000481839.1.32520 WP_000481839.1.32603 WP_000481839.1.32728 WP_000481839.1.32745 WP_000481839.1.32818 WP_000481839.1.33105 WP_000481839.1.33723 WP_000481839.1.34227 WP_000481839.1.34276 WP_000481839.1.34467 WP_000481839.1.34475 WP_000481839.1.34828 WP_000481839.1.34896 WP_000481839.1.34906 WP_000481839.1.35216 WP_000481839.1.35428 WP_000481839.1.3543 WP_000481839.1.35443 WP_000481839.1.35451 WP_000481839.1.35908 WP_000481839.1.36095 WP_000481839.1.36202 WP_000481839.1.36258 WP_000481839.1.36408 WP_000481839.1.36594 WP_000481839.1.36776 WP_000481839.1.36800 WP_000481839.1.36878 WP_000481839.1.3691 WP_000481839.1.36977 WP_000481839.1.37018 WP_000481839.1.37098 WP_000481839.1.37124 WP_000481839.1.37523 WP_000481839.1.37570 WP_000481839.1.37692 WP_000481839.1.3814 WP_000481839.1.3845 WP_000481839.1.38578 WP_000481839.1.38699 WP_000481839.1.3880 WP_000481839.1.38910 WP_000481839.1.3927 WP_000481839.1.39284 WP_000481839.1.3930 WP_000481839.1.3937 WP_000481839.1.39386 WP_000481839.1.39495 WP_000481839.1.3963 WP_000481839.1.39656 WP_000481839.1.39673 WP_000481839.1.40015 WP_000481839.1.40203 WP_000481839.1.40241 WP_000481839.1.40359 WP_000481839.1.40538 WP_000481839.1.40650 WP_000481839.1.40694 WP_000481839.1.40765 WP_000481839.1.40774 WP_000481839.1.41269 WP_000481839.1.41329 WP_000481839.1.41338 WP_000481839.1.41399 WP_000481839.1.41663 WP_000481839.1.41785 WP_000481839.1.41865 WP_000481839.1.42144 WP_000481839.1.4215 WP_000481839.1.42225 WP_000481839.1.42271 WP_000481839.1.42540 WP_000481839.1.42686 WP_000481839.1.42844 WP_000481839.1.43138 WP_000481839.1.43199 WP_000481839.1.4323 WP_000481839.1.44371 WP_000481839.1.44374 WP_000481839.1.44712 WP_000481839.1.44727 WP_000481839.1.44746 WP_000481839.1.44957 WP_000481839.1.45 WP_000481839.1.45058 WP_000481839.1.45103 WP_000481839.1.45150 WP_000481839.1.45180 WP_000481839.1.45540 WP_000481839.1.45553 WP_000481839.1.45790 WP_000481839.1.45896 WP_000481839.1.45976 WP_000481839.1.46043 WP_000481839.1.46116 WP_000481839.1.46992 WP_000481839.1.47044 WP_000481839.1.47485 WP_000481839.1.47497 WP_000481839.1.47584 WP_000481839.1.47608 WP_000481839.1.48052 WP_000481839.1.48120 WP_000481839.1.48239 WP_000481839.1.48416 WP_000481839.1.48518 WP_000481839.1.48557 WP_000481839.1.49082 WP_000481839.1.49278 WP_000481839.1.49371 WP_000481839.1.49421 WP_000481839.1.49423 WP_000481839.1.49508 WP_000481839.1.49888 WP_000481839.1.49965 WP_000481839.1.50082 WP_000481839.1.50186 WP_000481839.1.5019 WP_000481839.1.50326 WP_000481839.1.50420 WP_000481839.1.5055 WP_000481839.1.50552 WP_000481839.1.50639 WP_000481839.1.50776 WP_000481839.1.50874 WP_000481839.1.51102 WP_000481839.1.51114 WP_000481839.1.5137 WP_000481839.1.51547 WP_000481839.1.51570 WP_000481839.1.51780 WP_000481839.1.52139 WP_000481839.1.52273 WP_000481839.1.52401 WP_000481839.1.52470 WP_000481839.1.52514 WP_000481839.1.52634 WP_000481839.1.52729 WP_000481839.1.52826 WP_000481839.1.52916 WP_000481839.1.52981 WP_000481839.1.53013 WP_000481839.1.53087 WP_000481839.1.53549 WP_000481839.1.54107 WP_000481839.1.54156 WP_000481839.1.5437 WP_000481839.1.54416 WP_000481839.1.54423 WP_000481839.1.54487 WP_000481839.1.5451 WP_000481839.1.54629 WP_000481839.1.54752 WP_000481839.1.54757 WP_000481839.1.54818 WP_000481839.1.54821 WP_000481839.1.54844 WP_000481839.1.54896 WP_000481839.1.54978 WP_000481839.1.55451 WP_000481839.1.55542 WP_000481839.1.55655 WP_000481839.1.55673 WP_000481839.1.55753 WP_000481839.1.55775 WP_000481839.1.55921 WP_000481839.1.56043 WP_000481839.1.56192 WP_000481839.1.56208 WP_000481839.1.564 WP_000481839.1.56404 WP_000481839.1.56602 WP_000481839.1.56930 WP_000481839.1.57174 WP_000481839.1.57262 WP_000481839.1.57320 WP_000481839.1.57336 WP_000481839.1.57347 WP_000481839.1.57407 WP_000481839.1.57557 WP_000481839.1.57586 WP_000481839.1.57721 WP_000481839.1.57900 WP_000481839.1.58075 WP_000481839.1.58119 WP_000481839.1.58208 WP_000481839.1.58254 WP_000481839.1.58255 WP_000481839.1.58313 WP_000481839.1.58988 WP_000481839.1.59040 WP_000481839.1.59057 WP_000481839.1.59196 WP_000481839.1.59460 WP_000481839.1.59565 WP_000481839.1.5977 WP_000481839.1.59783 WP_000481839.1.5999 WP_000481839.1.60058 WP_000481839.1.60093 WP_000481839.1.60159 WP_000481839.1.60593 WP_000481839.1.60702 WP_000481839.1.6096 WP_000481839.1.61032 WP_000481839.1.61176 WP_000481839.1.61267 WP_000481839.1.6131 WP_000481839.1.61433 WP_000481839.1.61458 WP_000481839.1.61581 WP_000481839.1.61790 WP_000481839.1.61844 WP_000481839.1.62057 WP_000481839.1.62267 WP_000481839.1.62276 WP_000481839.1.62362 WP_000481839.1.62758 WP_000481839.1.63086 WP_000481839.1.6321 WP_000481839.1.63345 WP_000481839.1.63363 WP_000481839.1.63367 WP_000481839.1.63394 WP_000481839.1.63482 WP_000481839.1.63508 WP_000481839.1.6360 WP_000481839.1.63764 WP_000481839.1.63980 WP_000481839.1.63991 WP_000481839.1.64206 WP_000481839.1.64256 WP_000481839.1.64297 WP_000481839.1.64352 WP_000481839.1.64459 WP_000481839.1.64468 WP_000481839.1.64651 WP_000481839.1.64713 WP_000481839.1.64975 WP_000481839.1.65010 WP_000481839.1.65036 WP_000481839.1.65059 WP_000481839.1.65139 WP_000481839.1.65195 WP_000481839.1.65297 WP_000481839.1.65323 WP_000481839.1.65427 WP_000481839.1.6564 WP_000481839.1.65668 WP_000481839.1.66063 WP_000481839.1.66242 WP_000481839.1.66680 WP_000481839.1.66732 WP_000481839.1.67002 WP_000481839.1.67008 WP_000481839.1.67162 WP_000481839.1.67277 WP_000481839.1.67318 WP_000481839.1.67444 WP_000481839.1.67476 WP_000481839.1.67759 WP_000481839.1.67859 WP_000481839.1.68143 WP_000481839.1.68290 WP_000481839.1.6840 WP_000481839.1.68413 WP_000481839.1.68443 WP_000481839.1.68587 WP_000481839.1.68641 WP_000481839.1.68732 WP_000481839.1.68788 WP_000481839.1.68827 WP_000481839.1.68867 WP_000481839.1.68890 WP_000481839.1.68905 WP_000481839.1.69023 WP_000481839.1.69034 WP_000481839.1.69077 WP_000481839.1.69101 WP_000481839.1.69132 WP_000481839.1.69163 WP_000481839.1.69214 WP_000481839.1.69705 WP_000481839.1.6986 WP_000481839.1.7017 WP_000481839.1.70219 WP_000481839.1.70276 WP_000481839.1.70286 WP_000481839.1.70391 WP_000481839.1.70397 WP_000481839.1.70562 WP_000481839.1.70742 WP_000481839.1.70879 WP_000481839.1.70897 WP_000481839.1.70932 WP_000481839.1.71044 WP_000481839.1.71237 WP_000481839.1.71554 WP_000481839.1.71606 WP_000481839.1.71709 WP_000481839.1.7191 WP_000481839.1.72284 WP_000481839.1.7234 WP_000481839.1.72381 WP_000481839.1.72464 WP_000481839.1.72821 WP_000481839.1.73082 WP_000481839.1.73137 WP_000481839.1.73184 WP_000481839.1.73417 WP_000481839.1.73421 WP_000481839.1.73439 WP_000481839.1.73449 WP_000481839.1.7350 WP_000481839.1.73585 WP_000481839.1.73621 WP_000481839.1.73625 WP_000481839.1.73692 WP_000481839.1.73696 WP_000481839.1.74086 WP_000481839.1.74188 WP_000481839.1.74375 WP_000481839.1.74717 WP_000481839.1.74933 WP_000481839.1.74951 WP_000481839.1.75020 WP_000481839.1.75077 WP_000481839.1.75293 WP_000481839.1.7530 WP_000481839.1.7586 WP_000481839.1.7587 WP_000481839.1.75882 WP_000481839.1.76023 WP_000481839.1.76033 WP_000481839.1.76034 WP_000481839.1.7620 WP_000481839.1.76222 WP_000481839.1.76334 WP_000481839.1.76408 WP_000481839.1.76490 WP_000481839.1.76610 WP_000481839.1.76747 WP_000481839.1.76906 WP_000481839.1.76996 WP_000481839.1.77005 WP_000481839.1.77757 WP_000481839.1.77945 WP_000481839.1.78006 WP_000481839.1.78251 WP_000481839.1.78292 WP_000481839.1.78432 WP_000481839.1.78464 WP_000481839.1.78552 WP_000481839.1.7882 WP_000481839.1.78990 WP_000481839.1.78994 WP_000481839.1.7904 WP_000481839.1.791 WP_000481839.1.79117 WP_000481839.1.79135 WP_000481839.1.79372 WP_000481839.1.79474 WP_000481839.1.79724 WP_000481839.1.80046 WP_000481839.1.80180 WP_000481839.1.80340 WP_000481839.1.80460 WP_000481839.1.80706 WP_000481839.1.80895 WP_000481839.1.81115 WP_000481839.1.81168 WP_000481839.1.81280 WP_000481839.1.81303 WP_000481839.1.81477 WP_000481839.1.81506 WP_000481839.1.82198 WP_000481839.1.82293 WP_000481839.1.82501 WP_000481839.1.82730 WP_000481839.1.82982 WP_000481839.1.83071 WP_000481839.1.83198 WP_000481839.1.8340 WP_000481839.1.83429 WP_000481839.1.83465 WP_000481839.1.83494 WP_000481839.1.83616 WP_000481839.1.8362 WP_000481839.1.83723 WP_000481839.1.83944 WP_000481839.1.84093 WP_000481839.1.84119 WP_000481839.1.84227 WP_000481839.1.84289 WP_000481839.1.84343 WP_000481839.1.84909 WP_000481839.1.85015 WP_000481839.1.85030 WP_000481839.1.85179 WP_000481839.1.852 WP_000481839.1.85296 WP_000481839.1.85605 WP_000481839.1.8568 WP_000481839.1.85914 WP_000481839.1.85966 WP_000481839.1.8625 WP_000481839.1.86400 WP_000481839.1.86511 WP_000481839.1.86532 WP_000481839.1.86535 WP_000481839.1.86635 WP_000481839.1.86651 WP_000481839.1.86986 WP_000481839.1.87011 WP_000481839.1.87033 WP_000481839.1.87307 WP_000481839.1.87395 WP_000481839.1.87412 WP_000481839.1.87697 WP_000481839.1.87807 WP_000481839.1.87810 WP_000481839.1.87880 WP_000481839.1.87882 WP_000481839.1.88071 WP_000481839.1.88248 WP_000481839.1.88262 WP_000481839.1.88296 WP_000481839.1.88344 WP_000481839.1.8861 WP_000481839.1.887 WP_000481839.1.88701 WP_000481839.1.88744 WP_000481839.1.88855 WP_000481839.1.89248 WP_000481839.1.89303 WP_000481839.1.89336 WP_000481839.1.89477 WP_000481839.1.89574 WP_000481839.1.89608 WP_000481839.1.90019 WP_000481839.1.90068 WP_000481839.1.90129 WP_000481839.1.90214 WP_000481839.1.90411 WP_000481839.1.90530 WP_000481839.1.90664 WP_000481839.1.90666 WP_000481839.1.90749 WP_000481839.1.90867 WP_000481839.1.90941 WP_000481839.1.91002 WP_000481839.1.91223 WP_000481839.1.9125 WP_000481839.1.91270 WP_000481839.1.91285 WP_000481839.1.9136 WP_000481839.1.91673 WP_000481839.1.91731 WP_000481839.1.92184 WP_000481839.1.92219 WP_000481839.1.92320 WP_000481839.1.92547 WP_000481839.1.92590 WP_000481839.1.92647 WP_000481839.1.92762 WP_000481839.1.9295 WP_000481839.1.93080 WP_000481839.1.933 WP_000481839.1.93303 WP_000481839.1.93323 WP_000481839.1.93358 WP_000481839.1.93537 WP_000481839.1.93607 WP_000481839.1.93825 WP_000481839.1.9386 WP_000481839.1.93881 WP_000481839.1.93884 WP_000481839.1.94194 WP_000481839.1.94310 WP_000481839.1.94370 WP_000481839.1.94457 WP_000481839.1.94532 WP_000481839.1.94803 WP_000481839.1.94868 WP_000481839.1.94973 WP_000481839.1.95328 WP_000481839.1.95394 WP_000481839.1.95658 WP_000481839.1.95950 WP_000481839.1.95993 WP_000481839.1.96087 WP_000481839.1.96116 WP_000481839.1.96137 WP_000481839.1.96406 WP_000481839.1.96475 WP_000481839.1.96868 WP_000481839.1.96943 WP_000481839.1.96986 WP_000481839.1.9711 WP_000481839.1.97166 WP_000481839.1.9741 WP_000481839.1.97621 WP_000481839.1.97630 WP_000481839.1.97836 WP_000481839.1.97838 WP_000481839.1.97850 WP_000481839.1.98063 WP_000481839.1.98185 WP_000481839.1.9822 WP_000481839.1.98370 WP_000481839.1.98584 WP_000481839.1.98638 WP_000481839.1.98766 WP_000481839.1.98773 WP_000481839.1.98832 WP_000481839.1.98979 WP_000481839.1.99017 WP_000481839.1.99019 WP_000481839.1.99056 WP_000481839.1.99149 WP_000481839.1.99241 WP_000481839.1.99286 WP_000481839.1.99447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]