SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 212717.CTC01006 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  212717.CTC01006
Domain Number 1 Region: 1-180
Classification Level Classification E-value
Superfamily Flavoproteins 7.92e-43
Family Hypothetical protein YwqN 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 212717.CTC01006
Sequence length 185
Comment (Clostridium tetani E88)
Sequence
MKVLVLFSSPNKKGNTFKLLEKFLEGLNQEVDFIDVYHKKIGPCIDCKVCYKIEECAIKD
DMIEIYKKINESDLIVIATPIYFANVPSPLKALIDRLQVYWSKKYIRKDRENIREKTGVV
LAVGGTYWDNMFMSSEEVLGLAFAAMDVKDIHKVYGVNTDHIPIEKNEEIMKKAYDLGCE
LKNKY
Download sequence
Identical sequences A0A1T4LTA1 Q896J7
WP_011099255.1.12609 WP_011099255.1.27827 WP_011099255.1.49058 WP_011099255.1.81004 WP_011099255.1.83101 WP_011099255.1.96257 212717.CTC01006 gi|28210712|ref|NP_781656.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]