SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 214092.YPO2884 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  214092.YPO2884
Domain Number 1 Region: 99-206
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 4.83e-20
Family Crystallins/Ca-binding development proteins 0.0019
Further Details:      
 
Domain Number 2 Region: 14-108
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 0.00000000000000258
Family Crystallins/Ca-binding development proteins 0.01
Further Details:      
 
Weak hits

Sequence:  214092.YPO2884
Domain Number - Region: 696-805
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000146
Family N-acetyl transferase, NAT 0.063
Further Details:      
 
Domain Number - Region: 323-406
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000316
Family Exotoxin A, N-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 214092.YPO2884
Sequence length 806
Comment (Yersinia pestis CO92)
Sequence
MRYNRNHMLTLMFSLLIFDAYANEPKVCFYMDDDYNGESLCAAQGNSVASIPDKWNDRIS
SISIPHGLVVTVYEDVDFLGASRSFEADVDLVSDKDLIYLNDNISAFKIKKAVCFYGESN
FTGDSLCLSSGEQFDLYRGNYPERKQSHLVNPLNDEVYSIKIPPGMQTTVYEDDDYNGKY
FVLTEDYTPDDLLIIRMNNKISSMRVSQDEDFICDRFCSIKKSIKFKIQKSFGSYWIDPR
IKYRDILLDFQLSDTDDYSIKFFDEGLIKVKNYKLFFFDGNEKHGEGFLFNLSDKSSNLS
FLLRFNGGFFQIQFVESLNNEIVYSSPLIGTLFDDANSDVIFDINNVDANSPIVIDKMVL
TVGKEHNRAERSTLGLATCWAIPILSIYNYIVQGHCNQADKFVHNAADFFGSPADKILQI
FGSSLPLPPKNSNETLDDESALINFMSDVKGTLTYITTNMGEHALTVPATALACKASMRE
KILPHLRNRRDLAPGCIDWTLSILTDFTLLFGASIEYWNSKNFGRVIENIVREGEIGSAV
ADVDTASRLIESVQAHVAEATEVADIIHLKTAFDFSQLSYVSYVRHTEEEVVSPQSAQAL
PLGRYELALVDYHFIETVPRIRQDGRWVERPDLHFDIEVISGVPEETDASRQVLLPIIEA
WQHSYSQQELLFHASDILPESSLARYEIEPLLEASRLTSEVAISWLRTSRDDFVYVVVRL
EGEVISLTMAVDININDVGVAGSLTNPDYVITPNAEGAVRGAGTAAIRALADHFKRKGKI
SLVSSVISQPSAIVKKKVGFRFIEEL
Download sequence
Identical sequences A0A0E1NUD2 A0A0H2W778 A0A0H2YHH9 A0A208S0Y0 Q7CJN0
gi|145599501|ref|YP_001163577.1| gi|384126878|ref|YP_005509492.1| 187410.y1348 214092.YPO2884 229193.YP_2750 360102.YPA_2324 377628.YPN_1254 386656.YPDSF_2229 gi|45442522|ref|NP_994061.1| gi|294504554|ref|YP_003568616.1| gi|384139299|ref|YP_005522001.1| gi|384122855|ref|YP_005505475.1| gi|108811417|ref|YP_647184.1| gi|218929944|ref|YP_002347819.1| WP_002215515.1.10105 WP_002215515.1.101928 WP_002215515.1.102012 WP_002215515.1.12463 WP_002215515.1.12857 WP_002215515.1.1388 WP_002215515.1.14063 WP_002215515.1.16243 WP_002215515.1.16333 WP_002215515.1.17608 WP_002215515.1.17873 WP_002215515.1.18640 WP_002215515.1.18826 WP_002215515.1.19425 WP_002215515.1.2064 WP_002215515.1.21879 WP_002215515.1.23157 WP_002215515.1.23271 WP_002215515.1.23687 WP_002215515.1.24002 WP_002215515.1.25181 WP_002215515.1.2640 WP_002215515.1.26960 WP_002215515.1.27251 WP_002215515.1.28647 WP_002215515.1.29355 WP_002215515.1.29622 WP_002215515.1.29685 WP_002215515.1.29814 WP_002215515.1.3092 WP_002215515.1.31496 WP_002215515.1.31739 WP_002215515.1.32343 WP_002215515.1.32446 WP_002215515.1.33203 WP_002215515.1.33937 WP_002215515.1.35389 WP_002215515.1.35538 WP_002215515.1.36088 WP_002215515.1.37494 WP_002215515.1.37863 WP_002215515.1.38824 WP_002215515.1.38993 WP_002215515.1.39066 WP_002215515.1.3976 WP_002215515.1.40134 WP_002215515.1.40853 WP_002215515.1.42490 WP_002215515.1.44408 WP_002215515.1.45214 WP_002215515.1.46262 WP_002215515.1.46545 WP_002215515.1.46731 WP_002215515.1.4678 WP_002215515.1.47387 WP_002215515.1.48722 WP_002215515.1.4997 WP_002215515.1.50010 WP_002215515.1.50093 WP_002215515.1.51293 WP_002215515.1.51588 WP_002215515.1.51934 WP_002215515.1.52158 WP_002215515.1.52734 WP_002215515.1.53838 WP_002215515.1.53953 WP_002215515.1.54951 WP_002215515.1.5592 WP_002215515.1.56912 WP_002215515.1.57585 WP_002215515.1.57657 WP_002215515.1.58067 WP_002215515.1.59102 WP_002215515.1.59431 WP_002215515.1.5957 WP_002215515.1.59635 WP_002215515.1.59789 WP_002215515.1.60437 WP_002215515.1.60707 WP_002215515.1.60896 WP_002215515.1.62232 WP_002215515.1.62342 WP_002215515.1.6270 WP_002215515.1.64142 WP_002215515.1.64910 WP_002215515.1.65554 WP_002215515.1.65718 WP_002215515.1.66118 WP_002215515.1.66616 WP_002215515.1.67404 WP_002215515.1.68361 WP_002215515.1.69018 WP_002215515.1.69316 WP_002215515.1.70171 WP_002215515.1.70417 WP_002215515.1.7169 WP_002215515.1.71744 WP_002215515.1.72486 WP_002215515.1.7518 WP_002215515.1.75636 WP_002215515.1.75689 WP_002215515.1.77387 WP_002215515.1.77429 WP_002215515.1.78004 WP_002215515.1.7841 WP_002215515.1.78556 WP_002215515.1.79550 WP_002215515.1.79981 WP_002215515.1.8009 WP_002215515.1.80331 WP_002215515.1.81848 WP_002215515.1.81877 WP_002215515.1.8210 WP_002215515.1.82133 WP_002215515.1.82619 WP_002215515.1.8303 WP_002215515.1.8420 WP_002215515.1.84720 WP_002215515.1.8559 WP_002215515.1.85802 WP_002215515.1.86034 WP_002215515.1.87418 WP_002215515.1.8762 WP_002215515.1.87988 WP_002215515.1.88472 WP_002215515.1.8964 WP_002215515.1.90624 WP_002215515.1.91373 WP_002215515.1.92030 WP_002215515.1.92331 WP_002215515.1.92604 WP_002215515.1.9311 WP_002215515.1.9320 WP_002215515.1.93623 WP_002215515.1.94052 WP_002215515.1.94201 WP_002215515.1.94683 WP_002215515.1.97448 WP_002215515.1.97791 WP_002215515.1.97894 WP_002215515.1.99109 WP_002215515.1.99990 YP_002347819.1.25044 gi|22125247|ref|NP_668670.1| gi|108808318|ref|YP_652234.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]