SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 214684.CNA02410 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  214684.CNA02410
Domain Number 1 Region: 13-113
Classification Level Classification E-value
Superfamily POZ domain 9.42e-28
Family BTB/POZ domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 214684.CNA02410
Sequence length 113
Comment (Cryptococcus neoformans var JEC21)
Sequence
MSAGKKAQTQPPEDDYVLLESADGYTFVVSRKIACASGMLKSMLDEDAAFEESKNKTCRI
QQRGVILAKVIEYLAYKVQWSECLAEEVNEDFSDRIDPYIALELLTAADFLDC
Download sequence
Identical sequences F5H917 Q5KPL1
181.m08002 sgtc|cn01233 XP_566632.1.95466 XP_778226.1.65578 214684.CNA02410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]