SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 214684.CNA05790 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  214684.CNA05790
Domain Number 1 Region: 67-303
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-44
Family Glycosyl hydrolases family 16 0.00028
Further Details:      
 
Weak hits

Sequence:  214684.CNA05790
Domain Number - Region: 30-62
Classification Level Classification E-value
Superfamily Plant lectins/antimicrobial peptides 0.00105
Family Hevein-like agglutinin (lectin) domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 214684.CNA05790
Sequence length 376
Comment (Cryptococcus neoformans var JEC21)
Sequence
MIRLNIPLFAFTTTLIIALLPNAAAQTCNTTNLCPSAAPCCSEYGYCGTGSYCLGGCEPL
YSHEVTSCRPNPICTSFKTEFTDLSRVQLNASLYDGNATAYDWVVNTGSLVASSDNDGAR
LILTQNNTGSKISSTRYIHYGTIDFTLQTSKWAGVVTAAITMSDVKDEIDWEWPGSNTDM
VQTNYWFLGVANYSATEGASSSVSSDTATNFHTYTIDWQESYISWSIDGLLVRTVRKIDT
ISEDGTQYKFPSTPSRVQISIWPAGTDDNAQGTIDWAGGYIDWTNSDYLFNGYFWNTIKS
VNISCAYDTASSGATGWAYSGNDTSGIPIVTITNASTLISAGRKRIVEVQTNSRAIGGVG
LLVISGFAFFGGVALF
Download sequence
Identical sequences Q5KNP5
214684.CNA05790 XP_566898.1.95466 181.m08329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]