SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 214684.CNB00870 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  214684.CNB00870
Domain Number 1 Region: 24-100
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.52e-16
Family Canonical RBD 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 214684.CNB00870
Sequence length 282
Comment (Cryptococcus neoformans var JEC21)
Sequence
MHLHLLVQIPTLHSTPTAMAILSTPSPTLYVSGLETKTKKPELRQQLYALFSPYGRVIDV
VAKKHDGGRGQAFVVFEEQVAATAALRGLTGETFYNRELARLFISLPAIRLTPSREYHTP
KNRRTPPPPVKTLQPPGKQPLSRPPNSPFPEPKTSMSSLKRRDTMKRPVSWARREAWKTR
GTKGEQRGLNRRTMRRWRLRWMRKKMRRNRCSSAQIFPQSVMPISWVLSSLNIKASSPPP
NSRPPSHLLPPTPSPIPAPSLSTLHSSQGIRPPRQRTRLMAI
Download sequence
Identical sequences F5HHV3
214684.CNB00870 186.m03499 XP_569094.1.95466 XP_776956.1.65578 sgtc|cn02488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]