SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 214684.CNC05240 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  214684.CNC05240
Domain Number - Region: 75-153
Classification Level Classification E-value
Superfamily eIF1-like 0.0116
Family eIF1-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 214684.CNC05240
Sequence length 153
Comment (Cryptococcus neoformans var JEC21)
Sequence
MLARRSLLAARTFAAPLRQRTPLFLSARNLSTATAPLSQSTSTTTQYTQPEAAEPEFDLA
GRREKWYHIMRTRQGELPVYAKYRNDGGCKTIVRKIEGDSHTLKDQLNEWFEQSHLDPFT
RPPQATVKPTNGEVQIKGHWVEEIKDFLSDRGF
Download sequence
Identical sequences F5HHV7 Q5KJV4
XP_569711.1.95466 XP_776702.1.65578 214684.CNC05240 sgtc|cn03198 179.m00452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]