SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 214684.CNC06000 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  214684.CNC06000
Domain Number 1 Region: 36-299
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.05e-78
Family Calponin-homology domain, CH-domain 0.000044
Further Details:      
 
Domain Number 2 Region: 318-438
Classification Level Classification E-value
Superfamily Spectrin repeat 3.67e-23
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 3 Region: 544-640
Classification Level Classification E-value
Superfamily EF-hand 0.00000000714
Family Calmodulin-like 0.012
Further Details:      
 
Domain Number 4 Region: 625-706
Classification Level Classification E-value
Superfamily EF-hand 0.00000408
Family EF-hand modules in multidomain proteins 0.027
Further Details:      
 
Weak hits

Sequence:  214684.CNC06000
Domain Number - Region: 438-482
Classification Level Classification E-value
Superfamily Mediator hinge subcomplex-like 0.0471
Family CSE2-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 214684.CNC06000
Sequence length 708
Comment (Cryptococcus neoformans var JEC21)
Sequence
MWSPQVDMERRASQQSALSPTPPTNKHGRTKSLSAISNFNAAMNINAGGPGGGAPMSPVR
MGSPLIGPGGAVEFEWADIQARTFCRWLNKQLESHGLEPMTDVVKDFSSGVKLIQLLEII
SEESLGRYVKNPRLRVQKAENAAKALNFIRSKGIKLTNIGPEDIVDGNLKLILGMIWTLI
LRFTIANITESGLSARDGLLLWCQRKTTGYNPEVDVQNFKGSFADGLALCALIHYHRPEL
LDYHGLDKADKRNNTELAFKVAEEKLGIPRLLEVKDLCDVEVPDERSVMTYVAEFFHKFS
SEDKAETGARRVEKFAEVMQGVWANKNDFERRLDLLLSALSVTEQSWFIAPQPSTYPEAI
SYLAQFNDYKRTSKREWVKERQELAALYSNIQTKIRTYSLKPWEPSEGARLEDLEKRWAE
FLVSETARSRAINASVRDIKETLKKKFARAAEDFIHRLQQIEQAIGALAGPLPQQKQTLS
QLSSSIPSLYKLLSTEISDLNNSCLEAKVEENDYTVLTVDDLEYELELAEVGLKKKIAFI
DNQLVSAQHTNITPAKLEEFEATFKHFAWEETNTLGMWEMHSALASLGIVYAEEELETIF
SELEQHFGAVTYEAWLSLLVNITQDDASSPEQLREAFRGMAGEKPYVTDLDFEYAHLPKE
TVRFLQEAMPETSELPELEEGMERPANGTTKAYDYNSFLEVAFAQQCI
Download sequence
Identical sequences F5HAT4 Q5KJM5
sgtc|cn03121 214684.CNC06000 XP_569979.1.95466 XP_776625.1.65578 179.m00732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]