SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 214684.CND02660 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  214684.CND02660
Domain Number 1 Region: 76-169
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.82e-23
Family Cold shock DNA-binding domain-like 0.00048
Further Details:      
 
Domain Number 2 Region: 165-239
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.12e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 214684.CND02660
Sequence length 247
Comment (Cryptococcus neoformans var JEC21)
Sequence
MPTLILPGETVPIPSTSKAVVLGPGISQSTPTLQASSSTASGSSSAQGYIATRLGMLHSG
KGKERSQKLWIEGNSKRYIPAQKDIVLGIIIARHADGYRVDLGSSQMAQLDALAFEGATK
RSKPNLKVGTLVFARVMSASRDMEPELECFDPNTGKSDGFGELKGGVMVNATLQLCRRLL
DRNHIVLPTIASIFPFEIAIGLNGRVWMKAETVGETLAMKRLIESVDDHIIPVEEKAIKE
KLREYLS
Download sequence
Identical sequences F5HHT9 Q5KIK2
XP_570241.1.95466 XP_775962.1.65578 sgtc|cn04375 214684.CND02660 163.m02754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]