SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 214684.CND05510 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  214684.CND05510
Domain Number 1 Region: 143-247
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.34e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 214684.CND05510
Sequence length 402
Comment (Cryptococcus neoformans var JEC21)
Sequence
MSAKNQKRKATDIPADSTEVQDKNKRHRKDKPWDTDDIDHWAMEEFKAPNPETHKPFLEE
SSFALLFPKYREPYLRSVWSSITSALEAYGLACELDLVQGKMTVKTTRKTWDPYIIFKGR
DLLKLLARGVNAPQAIKILEDGIACDIIKIGGIVRNKERFVKRRQRIVGPNGSTLKAIEL
LTECYVLVQGNTVSVMGSYKGLKEVRRIILDCMNNIHPIYRIKELMIRRELAKDPKLANE
NWDRFLPKFQKKHLKTSEKTAKKNAALEREAASASSANANHIPLGTSSASIPAPAPVPVP
ASIPAPTTSSTETKEKKKKKVYTPFPPPQQPSKLDLQLASGEYFLKPKEKEAIDKRKKME
KQKEVAQERRAVREEAFVAPPEKRDETVEERRKKRRKAEEFM
Download sequence
Identical sequences F5HFA9 Q5KHS1
214684.CND05510 163.m06315 sgtc|cn04086 XP_570142.1.95466 XP_776036.1.65578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]