SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 214684.CNE00610 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  214684.CNE00610
Domain Number 1 Region: 238-377
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 5.04e-55
Family P-domain of calnexin/calreticulin 0.00000143
Further Details:      
 
Domain Number 2 Region: 29-248
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.43e-50
Family Calnexin/calreticulin 0.00000233
Further Details:      
 
Weak hits

Sequence:  214684.CNE00610
Domain Number - Region: 381-424
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000427
Family Calnexin/calreticulin 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 214684.CNE00610
Sequence length 551
Comment (Cryptococcus neoformans var JEC21)
Sequence
MRPQNVAGVAGTGALIMAAGALADQTVFHPTSLTAPFIEQFIESIPDSRWTVSRATKQTP
VGDEIFSYVGQWEVEEPEVYPGIPGDKGLVLKTKAAHHAISTLFTEPIDPKGKSLVVQYE
VKLQKGLECGGAYIKLLTDQQDEGLRAGEDYTDKTPFTIMFGPDKCGSTNKVHFIFRHKN
PLTGEWEEKHLKNPPSPKITKTTALYTLITNPDQTFEILINDESVRKGSLLEDFDPAVNP
PKEIDDPEDFKPETWVDEAEIEDVTATKPDDWDEDAPMMITDASATKPEDWLEEEPETIP
DPEAEKPEEWDDEEDGDWIPPMVPNPKCEDVSGCGPWTAPKIRNPDYKGKWTVPRIPNPE
YKGPWAPRKIANPAFFEDLHPSDFTKIGGVGIELWTMTEDILFDNLYIGHDAAQAKKFAE
ETYHVKKPIEKEAEGSNEDELEEPSSLVEKVQLKVYEFLHLATFDIAQAVKQMPEVAAGL
AAAVFTLLGMLLALFGFIGSAPTKVRQTTVKTKAVAPVAPAGEEEKKALDQAGVEVPAEG
SKKRVTRSTKE
Download sequence
Identical sequences F5HFL2 Q5KHB5
sgtc|cn05056 167.m03218 214684.CNE00610 XP_570776.1.95466 XP_775337.1.65578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]