SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 214684.CNH03820 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  214684.CNH03820
Domain Number 1 Region: 4-123
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.59e-16
Family Glycosyl hydrolases family 16 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 214684.CNH03820
Sequence length 136
Comment (Cryptococcus neoformans var JEC21)
Sequence
MADGLAFWTSDGIPGIQVDHWSDTAVGANRNSVRITTKSLFEGGLFIIDLALMPWGCGVW
PAFWTLGYEGTWPETSNDYVSSAPKGGSGCSIISASNSSYGMPFNSAGGGVFAMKWDTDG
IRMSSLRRRLIPTLVG
Download sequence
Identical sequences 214684.CNH03820 214684.CNL03820 XP_568246.1.95466 XP_572586.1.95466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]