SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 214684.CNJ00260 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  214684.CNJ00260
Domain Number 1 Region: 259-343
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.45e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00082
Further Details:      
 
Domain Number 2 Region: 160-235
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.94e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00099
Further Details:      
 
Domain Number 3 Region: 73-152
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000278
Family Eukaryotic type KH-domain (KH-domain type I) 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 214684.CNJ00260
Sequence length 357
Comment (Cryptococcus neoformans var JEC21)
Sequence
MSASPSATAPPEASPTATPTTATTSKRPASPDNAEDSAKRPKQDQNKMADVEMQNEGSPK
TAPSSEPTAPAKPDPGPQQISMRSLIVTQDASIIIGRGGAHVNEIREKSSARVTVSESIP
GNPERILNVSGPLDAVAKAFGLIVRRINDEPFDVPSVPGSRAVTIKFIIPNSRMGSVIGK
GGSKIKEIQEASGARLNASEAMLPGSTERVLSVSGVADAVHIAVYYIGTILLEYQDRYPS
NATGSYKQSQSRGPPPNSNAPPPPGMQTQQIFIPNALVGAIIGRGGSKINEIRSQSSCQI
RVTDPGTTVPGGAAANPEERLVTITGYPDNINAAVALLYSRVEAERAKLVEQNAGGM
Download sequence
Identical sequences F5HDU4 Q5KAW2
sgtc|cn10326 214684.CNJ00260 XP_567283.1.95466 XP_773048.1.65578 185.m02370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]