SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 214684.CNJ03110 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  214684.CNJ03110
Domain Number 1 Region: 16-151
Classification Level Classification E-value
Superfamily S13-like H2TH domain 3.97e-36
Family Ribosomal protein S13 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 214684.CNJ03110
Sequence length 155
Comment (Cryptococcus neoformans var JEC21)
Sequence
MSFAPLEAHQQFQHILRLLNTNVKGGGKIMYALTEIKGVGRRYANLVCKKADVDLNKRAG
ELNSDELERIVTIMQNPAQFKIPSWFLNRQRDISDGKSQHILSNVIDQRLREDLERLKKI
RTHRGLRHHWGLKVRGQHTKTTGRRVGRAVAGKKK
Download sequence
Identical sequences F5HCZ0 Q5KA46
185.m02663 sgtc|cn10042 214684.CNJ03110 XP_567390.1.95466 XP_773263.1.65578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]