SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 214684.CNK00060 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  214684.CNK00060
Domain Number 1 Region: 41-343
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 4.71e-92
Family Glycosyl hydrolases family 32 N-terminal domain 0.000000595
Further Details:      
 
Domain Number 2 Region: 371-517
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.32e-16
Family Glycosyl hydrolases family 32 C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 214684.CNK00060
Sequence length 519
Comment (Cryptococcus neoformans var JEC21)
Sequence
MFRSLVPVTIAGLAYVLQSLAQSTTSSAASVPTGVPIDGDYSGPYRPRVHFSPPKGFMND
PNGLHKDGNGTWHLYYQYNPTDIVAGNQHWGHATSPDLYHWTNQPIALFPPNSSSGVFSG
SAVIDTNNTSGFFPDQDNGVVAIYTLNTPTAQVQQIAYSKDGGYSFEEYEGNPVLDVGLT
QFRDPKVIWYEDHWVMVVAFPVDYVIGVYTSPDLKSWTHASNITHVGFLGLQYECPNMVS
IPIANSSDSSWVLTISINPGSPLGGSITQYFPGEFNGTHFTPYDSAARLTNFGKDDYAGQ
FFYDEPVSIGWASNWQYTNFVPTGEEGWRSAMTLPRKNYFTNITAAGWDLVQEVYDLSPV
LGDQLDTQQLVNKSSTATITEAAYIDVNFTIPDDASFAEYASLNFTVSTNSSGETVKGGY
FFAEPYSIAAWLDRRDTKAFESPFFTDKFSVAPAQQAKRLQVIIDRSLIEIYIDNGALVG
TMVAFPEEPFTKLEVTTAGLPDGMEVEVGVWDLKDSWTS
Download sequence
Identical sequences F5HDU7 Q5KA05
XP_567775.1.95466 XP_772633.1.65578 214684.CNK00060 176.m02143 sgtc|cn11340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]