SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 214684.CNK01380 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  214684.CNK01380
Domain Number - Region: 28-134
Classification Level Classification E-value
Superfamily POZ domain 0.00628
Family BTB/POZ domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 214684.CNK01380
Sequence length 255
Comment (Cryptococcus neoformans var JEC21)
Sequence
MSSDKSQVTPYGQSQATQYKTHPFHTKGDITLVSSDGVLFKADVWCLAHASAVFHDMLEM
SNPSVADTSTPESISVPAKPPHPSEPIDIPFPSRTLQLFLDLSRVSDDVMLAITMEEAGD
LLSFSHLYDLREFVLKKLKDRAMDLGRRRPWDLLVLASRLDLDDLGVSALEAMNEDTFVR
GQKGSTSNFWESIALLQNGWQSRIIKSVIDKPEGGSVRRPGYPDDYSYKTGYVFKLRDWS
EAGRRFRNTRLRDEQ
Download sequence
Identical sequences F5HDQ1 Q5K9N2
214684.CNK01380 sgtc|cn11218 XP_567817.1.95466 XP_772844.1.65578 176.m02277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]