SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 216389.DehaBAV1_0069 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  216389.DehaBAV1_0069
Domain Number - Region: 290-405
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00265
Family Glycosyl hydrolases family 16 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 216389.DehaBAV1_0069
Sequence length 581
Comment (Dehalococcoides BAV1)
Sequence
MKKLIISVGMLILATIIGPGTILASTITDAIYQANIRATNASYTATHVAAPFTWATDSLL
DGYYIDSEFNNLAMRDSIGNDIPFMPGQGSDPWIMWIDQIAQNSAINYNLYTGGETAMGG
KLAYCPDTAGMTVADAASLELGNSFEIELSGRFNDGYNLSKFGAFWIYTSGTDVSAGNSS
SYTETPYNGTASSATSMYGANWIAQTFQFSNDVAVNQFTFRTQRVGNPTGNFNYAIYATS
GDVPTGSALVSGSVVASTISTSAVNHTFDFSNIINLTAGTRYAIVLSLPNGDSSNKLTHW
YNPTNPYANGRYCTTNNSGSSWSGTATTDINISITGNANNTIVTAADISSSEHVYKISLS
AGTMNIYIDGLLEGSAAFAVSITDNANNLVIGANGSMPYLYYAKITVGGVLRGSWEWQYA
ATFTDLSGNGNDATPSFRTTTTDADVSVSVISYTACNQSAFITGEDDEAVEIVTDDDIGE
MPDGWYGDLHPENLPGGQAISDFLENMDFPPAFFWYSLVYLGAAIVTMVSLGLTSELLPC
AAAGLIWQIFFCAIIGTSWWVLLPEGIIIIGEMVNRKLASY
Download sequence
Identical sequences gi|147668721|ref|YP_001213539.1| WP_011928594.1.45256 216389.DehaBAV1_0069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]