SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 216389.DehaBAV1_1047 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  216389.DehaBAV1_1047
Domain Number 1 Region: 108-315
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.6e-38
Family Clostridium neurotoxins, the second last domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 216389.DehaBAV1_1047
Sequence length 316
Comment (Dehalococcoides BAV1)
Sequence
MQKPASLYLLYGIYIKPKRKSRQENCLSLNMLSLSKNRDCICRLARLKFYQSDRYLHNCI
RRFAMIRGCRVLKVISFIMAAAMLSGCTGAPAAEDNTPAESSSNQSNEILAGLVTVWYMD
EGTGNIIYDSTTSHNDGLISGASWVTGKKGYALSFNGEDNWVTVAQTFIFHQSAEATISF
WINPADTTHRPVFWTRSDNDDLNRYHIFCGWDNQPLFGFDYRSADSTLHEFGEFDIPLNQ
WTHIAISRFGNDYSIYRNGQLINQITDNSPSVPTYEGSWFIGRRNLTETLYKGLIDEIAI
YNRALSAAEVLSIYRG
Download sequence
Identical sequences gi|147669687|ref|YP_001214505.1| 216389.DehaBAV1_1047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]