SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 216389.DehaBAV1_1181 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  216389.DehaBAV1_1181
Domain Number 1 Region: 4-155
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.44e-34
Family Predicted metal-dependent hydrolase 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 216389.DehaBAV1_1181
Sequence length 160
Comment (Dehalococcoides BAV1)
Sequence
MEINVIVKPPFKKLVSAQFLKKIASETLKAQAADPSSELGIVITGQEEIKELNCKYRQLD
EPTDVLSFYMLEENPENLTAPDDFPTPPDEATHLGEVIISYPQAELQAGAAGHSVNHELA
FLLIHGVLHLLGYDHHETAAEAVMKSHQDIAMKHIREILE
Download sequence
Identical sequences A5FPW5
WP_012034133.1.45256 216389.DehaBAV1_1181 gi|147669820|ref|YP_001214638.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]