SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 216591.BCAM1404 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  216591.BCAM1404
Domain Number 1 Region: 39-371
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 2.2e-100
Family Glycosyl hydrolases family 32 N-terminal domain 0.0000000876
Further Details:      
 
Domain Number 2 Region: 384-533
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-31
Family Glycosyl hydrolases family 32 C-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 216591.BCAM1404
Sequence length 545
Comment (Burkholderia cenocepacia J2315)
Sequence
MKSTSFRCSVRLVRLLFACLACTQVVAAPCHAPPETGTPQWRPALHYTPQRNWMNDPNGL
VYENGRYHLFYQYNPLGNDWGNMSWGHATSTDLVHWREQPVAMRASATEEIFSGSIVADT
LNTSGLGTPGHTPLVALYTSVYKPGSGHAPGIQAQSLAYSLDQGTTWQPYAHNPVLTLDP
ESKEFRDPKVSWYAAGGYWLMTTVVADAQVVKLYRSDDLIHWSFLSDFTLPDVPHAGALW
EMPDLIPLPLDGDPKRIKWVMIVNVNPWSIAGGSGAMYFVGDFDGRTFTPDRVAPAGSDP
AQFRWVDHGADFYAAGTFSGAPGARPVAIAWMSNWDYAAKVPTTPWRGATTLPRELSLKA
IDGEPTLIVAPAAAFDAWADGRPAVHEGDLTVDSATRPLSAATRGGVQRITVTISPQRAA
RAGLIVRRSADGSIGTRIVYDTAKRTLTLDRARSGEANFAGTFSREHIVDLPLERGQLRL
EIVVDRGSVEVFANGGRVALTDLIFPPRDADRVAVFAEQGRATFAGLTVTQLQTGDDSRG
ACTAR
Download sequence
Identical sequences A0A1V2XDI8 B4EII0
WP_012493306.1.10003 WP_012493306.1.100706 WP_012493306.1.101897 WP_012493306.1.10541 WP_012493306.1.11355 WP_012493306.1.14088 WP_012493306.1.16401 WP_012493306.1.19923 WP_012493306.1.21852 WP_012493306.1.22015 WP_012493306.1.25261 WP_012493306.1.27304 WP_012493306.1.27889 WP_012493306.1.27910 WP_012493306.1.29408 WP_012493306.1.30820 WP_012493306.1.31157 WP_012493306.1.31547 WP_012493306.1.32758 WP_012493306.1.34650 WP_012493306.1.38451 WP_012493306.1.38687 WP_012493306.1.40288 WP_012493306.1.43021 WP_012493306.1.45869 WP_012493306.1.48439 WP_012493306.1.50670 WP_012493306.1.52424 WP_012493306.1.52705 WP_012493306.1.55547 WP_012493306.1.57568 WP_012493306.1.60885 WP_012493306.1.6376 WP_012493306.1.67103 WP_012493306.1.67642 WP_012493306.1.70514 WP_012493306.1.70783 WP_012493306.1.71578 WP_012493306.1.71608 WP_012493306.1.72171 WP_012493306.1.75651 WP_012493306.1.79353 WP_012493306.1.80650 WP_012493306.1.82360 WP_012493306.1.83528 WP_012493306.1.85579 WP_012493306.1.86231 WP_012493306.1.87780 WP_012493306.1.87798 WP_012493306.1.8869 WP_012493306.1.88782 WP_012493306.1.90806 WP_012493306.1.92582 WP_012493306.1.95357 WP_012493306.1.95626 WP_012493306.1.95790 WP_012493306.1.98001 WP_012493306.1.99008 gi|206563256|ref|YP_002234019.1| 216591.BCAM1404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]