SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 216591.BCAM1913 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  216591.BCAM1913
Domain Number 1 Region: 194-377
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-22
Family SPRY domain 0.013
Further Details:      
 
Weak hits

Sequence:  216591.BCAM1913
Domain Number - Region: 418-464
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 0.0389
Family MurCDEF 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 216591.BCAM1913
Sequence length 526
Comment (Burkholderia cenocepacia J2315)
Sequence
MADLKMNQFPDGQLSDTQMLVGYDPYAAASGERKYSGVNLVSYLTGALPFIGNSNPTING
ILTLNGDIHFSGGAIVTSLGDMYQVARGKWLSADMAKLDDAWNKASAAQSAADQAAISVA
QAATSASSASANAATASSAASTATQAQTSATGSATAAQAWASQPTGTVQGTSSYSSLYYA
GQSQYWAGISQAMVAAPTTFDPGYKHSSITLSNGNLTATFAGSQAVVLGTIGYATGKHYF
EITFASGSSSGNASVGIAPSNEPLDSQIGYDDNSGAVGAFQTSGNVYLNGSKVASVSGYG
NANDVIGVAVDADRKLVWFRSNSGEWNASGTADPASGTGGIAYTQTGKMFPAVCTDSSAV
FTANFSGNFKATIPTGFKAWAADAFHYVVPYATTSTPGIVVAGSGVSVDPYGKLSVDTYY
DMVSIQAQDTISIDLTAPVPGYHIVLNSQAATFALTNLQLPAGKALRLTFYFEQGTGNNT
ISSWDSRIKWVGSRPILAYTVGSRNVIELETIDGQTFAGYYIGQIN
Download sequence
Identical sequences B4EMH8
216591.BCAM1913 gi|206563763|ref|YP_002234526.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]