SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 216594.MMAR_0494 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  216594.MMAR_0494
Domain Number 1 Region: 21-256
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 7.59e-51
Family Glycerophosphoryl diester phosphodiesterase 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 216594.MMAR_0494
Sequence length 262
Comment (Mycobacterium marinum M)
Sequence
MGGDAHPQEVEFLRDARRIAMAHRGFTSFRFPMNSMGAFHEAAKIGFRYIETDVRATRDG
VAVIQHDRKLAPESGVAGAVDQLTWPEVSTADLGGGEPIPTLEELLVALPQMRFNIDIKA
DSAVEPTVEVIERLQAHRRVLIASFSERRRQRALRLMSQRVASAAGMGAFLGFMAARTAG
RRASAMRMLRDSDCLQLPARFGGLPVITPALVRSVHASRRQVHAWTIDDPAMMHALFDIG
VDGIITDRADVLCDVLGARGEW
Download sequence
Identical sequences B2HN19
gi|183980522|ref|YP_001848813.1| 216594.MMAR_0494 WP_012392464.1.28311 WP_012392464.1.33562 WP_012392464.1.39490 WP_012392464.1.90902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]