SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 216594.MMAR_1925 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  216594.MMAR_1925
Domain Number 1 Region: 14-156
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.62e-45
Family Ribonuclease PH domain 1-like 0.00000032
Further Details:      
 
Domain Number 2 Region: 333-505
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.06e-44
Family Ribonuclease PH domain 1-like 0.00000176
Further Details:      
 
Domain Number 3 Region: 157-263
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.75e-25
Family Ribonuclease PH domain 2-like 0.0000185
Further Details:      
 
Domain Number 4 Region: 487-590
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.96e-23
Family Ribonuclease PH domain 2-like 0.0000167
Further Details:      
 
Domain Number 5 Region: 265-362
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.02e-21
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00019
Further Details:      
 
Domain Number 6 Region: 599-685
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.8e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 
Domain Number 7 Region: 665-734
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000493
Family Cold shock DNA-binding domain-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 216594.MMAR_1925
Sequence length 762
Comment (Mycobacterium marinum M)
Sequence
MSVAETEEGVFEATATIDNGSFGTRTIRFETGRLAQQAAGSVVAYLDDENMLLSATTASK
NPKEHFDFFPLTVDVEERMYAAGRIPGSFFRREGRPSTDAILTCRLIDRPLRPSFVNGLR
NEIQVVVTILSLDPNDLYDVVAINAASASTQLAGLPFSGPVGGVRVALIDGQWVAFPNVE
QLERAVFDMVVAGRIVGTEEDGTPDVAIMMVEAEATDKVIELVEGGAPAPTESVVAQGLE
AAKPFIAALCTAQQELADASGATAKTGAEYPVFPEYGDDVYYAVSSVATDGLAAALTIGG
KAERNQRTEEIKAEVLERLADTYEGREKEIGAAFRSLTKKLVRQRIVTDHFRIDGRGITD
IRALSAEVALVPRAHGSALFERGETQILGVTTLDMVKMAQQIDSLGPETTKRYMHHYNFP
PFSTGETGRVGSPKRREIGHGALAERALMPVLPSVEEFPYAIRQVSEALGSNGSTSMGSV
CASTLALLNAGVPLKAPVAGIAMGLVSDDVEVDGKTERRFVTLTDILGAEDAFGDMDFKV
AGTKDFVTALQLDTKLDGIPSQVLAGALAQAKDARLTILEVMAEAIDTPDEMSPYAPRVT
TIKVPVDKIGEVIGPKGKVINSITEETGAQISIEDDGTVFVGATDGPSAQAAIDKINAIA
NPQLPTVGERFLGTVVKTTDFGAFVSLLPGRDGLVHISKLGKGKRIAKVEDVVNVGDKLR
VEIADIDKRGKISLVLVAEDDDSAAAAAADSPAPADAATASS
Download sequence
Identical sequences A0A1B4Y5E3 B2HKV3
gi|183981938|ref|YP_001850229.1| WP_012393717.1.28311 WP_012393717.1.39490 WP_012393717.1.48473 WP_012393717.1.90902 216594.MMAR_1925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]