SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 216594.MMAR_5055 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  216594.MMAR_5055
Domain Number 1 Region: 3-257
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.5e-111
Family Arylamine N-acetyltransferase 0.00000000608
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 216594.MMAR_5055
Sequence length 280
Comment (Mycobacterium marinum M)
Sequence
MALDLTGYLDRINYRGATDPTLDVLRDLVSAHTGAIAFENLDPLMGVPVDDLSAEALADK
LVDRRRGGYCYEHNGLIGYVLAELGYRVRRLAGRVVWLAPPDAPTPAQTHTVLAVTFPGC
QGPYLVDVGFGGMTPTAPLRLETGTVQQTALEPYRLDDRGDGLVLQAMVRDEWQALYEFS
TLTRPQVDLRVGSWFVSTHPTSHFVTGLMAATVADDARWNLMGRNLAIHRRGGTEKILLE
DAAAVVDTLGDRFGINVADVGERGRLEARIDKVCFGAENR
Download sequence
Identical sequences B2HIZ6
216594.MMAR_5055 2vfb_A 2vfc_A 2vfc_B 3ltw_A gi|183985023|ref|YP_001853314.1| WP_012396579.1.90902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]