SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 216595.PFLU2434 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  216595.PFLU2434
Domain Number 1 Region: 135-327
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.69e-29
Family Laminin G-like module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 216595.PFLU2434
Sequence length 599
Comment (Pseudomonas fluorescens SBW25)
Sequence
MQRLFLSLLICLGFALPATAHAWWQDDWHYRKQISVDTTAQGAAINQALGRTALLVRLHT
GNFTFDGVKDDGADLRFVSADDKTVFNHQIESFDPLMGMALIWVDVPKVEGGQRQDLWMY
YGNQKAPATANGQLTFDPNYTALYHFDGANGTPARDTTAYANTALNATGAAIDGVIGRAL
QFGGQPLMLPASPSLQHAAGGAFTFSAWLRLDQASGEQVVLARRDGTHSLLLGLNQGMPF
VDIDGQRAVSTQPLNPGQWQHLALTAEGEKVTLYVNGRETATLAVAMPAFNSQLAIGADL
PEAGSTHLPFAGAIDELRLSKVARPAALLLADASAQGAESKLVAYGVDEEQSGFGFGSLG
FLLNAVPVDAWVIILVLVAMMFQSWVIMLRKNRQVSRLSSANEVFREHFAQIGTRLEMYA
DDAQLGERLTHSSLWRLYLVAVKEIRTRRAQGADTSSVSAATIEAIRCSMDGVRTRENQA
LSSKLSTLSNAIAGGPYIGLLGTVLGIMVVFLGTAMAGDVNINAIAPGMAAALLATAMGL
FVAIPALFGYNRLITRNKEVSADMRVFVDEFITRLAEMHGESQHSEAAHRAPHHASVPA
Download sequence
Identical sequences C3K8K5
gi|229589913|ref|YP_002872032.1| WP_012723652.1.23922 216595.PFLU2434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]