SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 216595.PFLU4773 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  216595.PFLU4773
Domain Number 1 Region: 1-132
Classification Level Classification E-value
Superfamily PIN domain-like 2.8e-37
Family PIN domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 216595.PFLU4773
Sequence length 135
Comment (Pseudomonas fluorescens SBW25)
Sequence
MMIKYMLDTNIVIYIIKRRPIEILEKFNANVGRMVISSITLAELMHGAEKSQLVEKNTRA
VEDFSSRLDVLSYDDKAAFHYGSIRSDLEKKGTPIGVNDLHIAGHARSSGLVLVTNNEGE
FKRVNGLIVENWIGA
Download sequence
Identical sequences C3K0B9
gi|229592171|ref|YP_002874290.1| 216595.PFLU4773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]