SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 216596.RL0100 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  216596.RL0100
Domain Number - Region: 9-55
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0235
Family Myosin rod fragments 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 216596.RL0100
Sequence length 69
Comment (Rhizobium leguminosarum bv viciae 3841)
Sequence
MSDETNHITRLEEMLAHQAKTIEELSDQLAEQWKTVEQMRTKLDRLTERFLSLEEQSLDA
PAITRPPHY
Download sequence
Identical sequences A0A154IMI0 A0A1Q8H9D0 Q1MN64
WP_011649924.1.100861 WP_011649924.1.102073 WP_011649924.1.38826 WP_011649924.1.40175 WP_011649924.1.53662 WP_011649924.1.53928 WP_011649924.1.54942 WP_011649924.1.88983 WP_011649924.1.98283 gi|116249866|ref|YP_765704.1| 216596.RL0100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]