SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 216596.RL4037 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  216596.RL4037
Domain Number 1 Region: 4-83
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000275
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 216596.RL4037
Sequence length 97
Comment (Rhizobium leguminosarum bv viciae 3841)
Sequence
MPDVLSIRNVSELYSKFTDEFHSNDTIIISIPEGAEADLSFVQLIESSRRQAKAKGKTFK
LSSPASGSVLKVLERAGFIESFDHEDAKFWLHKEVTL
Download sequence
Identical sequences Q1MC05
216596.RL4037 gi|116253776|ref|YP_769614.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]