SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 216596.pRL110453 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  216596.pRL110453
Domain Number 1 Region: 3-182
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-27
Family Beta-D-xylosidase C-terminal domain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 216596.pRL110453
Sequence length 194
Comment (Rhizobium leguminosarum bv viciae 3841)
Sequence
MSIDFNDGKWLNEPAHWQATETGLILTTDEKTDFWRETHYGFTRDSGHFLAFPTTDSFTA
QIRVRGEFRTLYDQAGLMVRIDERRWVKTGVEFTDGEAYLSTVVTDGKSDWSVAQPFREL
EDFRIRVTVANGAMRIQASRDGSFWPLLRLAPFPAADHYEVGPTACTPERSGLTVRFCEF
SIGPAITTDLHDLS
Download sequence
Identical sequences Q1M5T3
216596.pRL110453 RlR239 gi|116255654|ref|YP_771487.1|NC_008384 gi|116255654|ref|YP_771487.1| WP_011655189.1.100861 WP_011655189.1.53928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]